Endometriosis Knowledgebase

Search Result

Gene id

130367

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SGPP2 Gene UCSC Ensembl

Aliases

SPP2, SPPase2

Gene name

sphingosine-1-phosphate phosphatase 2

Alternate names

sphingosine-1-phosphate phosphatase 2, sphingosine 1-phosphate phosphohydrolase 2, sphingosine-1-phosphatase 2, sphingosine-1-phosphate phosphotase 2,

Gene location

2q36.1 (222424051: 222562621) Exons: 7 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene is a transmembrane protein that degrades the bioactive signaling molecule sphingosine 1-phosphate. The encoded protein is induced during inflammatory responses and has been shown to be downregulated by the microRNA-31 tumor suppressor. Alternative splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2016]

OMIM

612827

Protein Summary

Protein general information

Q8IWX5

Name: Sphingosine-1-phosphate phosphatase 2 (SPPase2) (Spp2) (hSPP2) (EC 3.1.3.-) (Sphingosine-1-phosphatase 2)

Length: 399 Mass: 44,741

Tissue specificity: Expressed strongly in kidney and heart, followed by brain, colon, small intestine and lung. Not detected in skeletal muscle, thymus, spleen, liver, placenta, and peripheral blood leukocytes. {ECO

Sequence

MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEHLPAANGKGGEAPANGLRRAAAPEAY
VQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRRLIIIWVLVMYIGQVAKDVLKWPRPSSPPVV
KLEKRLIAEYGMPSTHAMAATAIAFTLLISTMDRYQYPFVLGLVMAVVFSTLVCLSRLYTGMHTVLDVLGGVLIT
ALLIVLTYPAWTFIDCLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPTRADTTTILAAGAGVTIGFWINHFFQLV
SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVLYSWFKVVTRNKEARRRLEIEVPYKF
VTYTSVGICATTFVPMLHRFLGLP

Structural information

Interpro:	IPR036938 IPR000326
Pfam:	PF01569
STRING:	ENSP00000315137;

Other Databases

GeneCards: SGPP2; Malacards: SGPP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006670	sphingosine metabolic pro cess	IDA	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016311	dephosphorylation	IEA	biological_process
GO:0030148	sphingolipid biosynthetic process	TAS	biological_process
GO:0042392	sphingosine-1-phosphate p hosphatase activity	IDA	molecular_function
GO:0042392	sphingosine-1-phosphate p hosphatase activity	TAS	molecular_function
GO:0070780	dihydrosphingosine-1-phos phate phosphatase activit y	TAS	molecular_function
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006670	sphingosine metabolic pro cess	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016311	dephosphorylation	IEA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0030148	sphingolipid biosynthetic process	TAS	biological_process
GO:0042392	sphingosine-1-phosphate p hosphatase activity	IDA	molecular_function
GO:0042392	sphingosine-1-phosphate p hosphatase activity	TAS	molecular_function
GO:0070780	dihydrosphingosine-1-phos phate phosphatase activit y	TAS	molecular_function
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006670	sphingosine metabolic pro cess	IDA	biological_process
GO:0030148	sphingolipid biosynthetic process	TAS	biological_process
GO:0042392	sphingosine-1-phosphate p hosphatase activity	IDA	molecular_function
GO:0042392	sphingosine-1-phosphate p hosphatase activity	TAS	molecular_function
GO:0070780	dihydrosphingosine-1-phos phate phosphatase activit y	TAS	molecular_function

KEGG pathways

hsa04071 Sphingolipid signaling pathway
hsa00600 Sphingolipid metabolism

Diseases

Associated diseases	References
Endometriosis	PubMed22277765

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22277765	Endometrio sis			47 (15 disease- free women, 16 eutopic endomet rium of endomet riosis-affected women, 16 ecto pic endometrium of endometrios is-affected wom en)			Show abstract