Endometriosis Knowledgebase

Search Result

Gene id

167465

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ZNF366 Gene UCSC Ensembl

Aliases

DCSCRIPT

Gene name

zinc finger protein 366

Alternate names

zinc finger protein 366,

Gene location

5q13.2 (72507421: 72439898) Exons: 5 NC_000005.10

OMIM

610159

Protein Summary

Protein general information

Q8N895

Name: Zinc finger protein 366 (Dendritic cell specific transcript protein) (DC SCRIPT)

Length: 744 Mass: 85,107

Tissue specificity: Expressed in immature and mature dendritic cells (DCs). Not detected in other blood cell types. {ECO

Sequence

MQKEMKMIKDEDVHFDLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRGPFSQFRYEPPPGDLDGFPGVFEGAG
SRKRKSMPTKMPYNHPAEEVTLALHSEENKNHGLPNLPLLFPQPPRPKYDSQMIDLCNVGFQFYRSLEHFGGKPV
KQEPIKPSAVWPQPTPTPFLPTPYPYYPKVHPGLMFPFFVPSSSPFPFSRHTFLPKQPPEPLLPRKAEPQESEET
KQKVERVDVNVQIDDSYYVDVGGSQKRWQCPTCEKSYTSKYNLVTHILGHSGIKPHACTHCGKLFKQLSHLHTHM
LTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPSELKAHEAKHASGRENICVECGLDFP
TLAQLKRHLTTHRGPIQYNCSECDKTFQYPSQLQNHMMKHKDIRPYICSECGMEFVQPHHLKQHSLTHKGVKEHK
CGICGREFTLLANMKRHVLIHTNIRAYQCHLCYKSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMH
LHSDSKPFKCLYCPSKFTLKGNLTRHMKVKHGVMERGLHSQGLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAK
VPVFQSDGESAQGSHCHEEEEEDNCYEVEPYSPGLAPQSQQLCTPEDLSTKSEHAPEVLEEACKEEKEDASKGEW
EKRSKGDLGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLERKMEKQAVLLGI

Structural information

Motifs	PXDLS. {ECO:0000269\|PubMed:16393996,(590-594)
Interpro:	IPR013087
Prosite:	PS00028 PS50157
STRING:	ENSP00000313158;

Other Databases

GeneCards: ZNF366; Malacards: ZNF366

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0030331	estrogen receptor binding	IDA	molecular_function
GO:0033147	negative regulation of in tracellular estrogen rece ptor signaling pathway	IDA	biological_process
GO:0043627	response to estrogen	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0030331	estrogen receptor binding	IDA	molecular_function
GO:0033147	negative regulation of in tracellular estrogen rece ptor signaling pathway	IDA	biological_process
GO:0043627	response to estrogen	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0030331	estrogen receptor binding	IDA	molecular_function
GO:0033147	negative regulation of in tracellular estrogen rece ptor signaling pathway	IDA	biological_process
GO:0043627	response to estrogen	IDA	biological_process

Diseases

Associated diseases	References
Atherosclerosis	PMID: 19525478
Endometriosis	PMID: 25722978
Endometriosis	INFBASE25722978

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25722978	Endometrio sis	rs227849, rs4703908, rs2479037, and rs966674	Caucasi an	647 (319 endome triotic patient , 308 controls)			Show abstract