Endometriosis Knowledgebase

Search Result

Gene id

253559

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CADM2 Gene UCSC Ensembl

Aliases

IGSF4D, NECL3, Necl-3, SynCAM 2, synCAM2

Gene name

cell adhesion molecule 2

Alternate names

cell adhesion molecule 2, immunoglobulin superfamily member 4D, nectin-like 3, nectin-like protein 3, synaptic cell adhesion molecule 2,

Gene location

3p12.1 (84958981: 86074428) Exons: 13 NC_000003.12

Gene summary(Entrez)

This gene encodes a member of the synaptic cell adhesion molecule 1 (SynCAM) family which belongs to the immunoglobulin (Ig) superfamily. The encoded protein has three Ig-like domains and a cytosolic protein 4.1 binding site near the C-terminus. Proteins belonging to the protein 4.1 family crosslink spectrin and interact with other cytoskeletal proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]

OMIM

609938

Protein Summary

Protein general information

Q8N3J6

Name: Cell adhesion molecule 2 (Immunoglobulin superfamily member 4D) (IgSF4D) (Nectin like protein 3) (NECL 3) (Synaptic cell adhesion molecule 2) (SynCAM 2)

Length: 435 Mass: 47,554

Sequence

MIWKRSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDN
RIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSG
SKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHY
TPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATN
TIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALAGQNGPDHALIGGIVA
VVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINAEGSQVNAEEKKEYFI

Structural information

Protein Domains	Ig-like (27-119) Ig-like (127-219) Ig-like (227-312)
Interpro:	IPR013162 IPR007110 IPR013783 IPR003599 IPR003598 IPR013106 IPR003585
Prosite:	PS50835
Pfam:	PF08205 PF07686
MINT:	4724723
STRING:	ENSP00000384193;

Other Databases

GeneCards: CADM2; Malacards: CADM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004872	receptor activity	IBA	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0005913	cell-cell adherens juncti on	IBA	cellular_component
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IBA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IBA	biological_process
GO:0008037	cell recognition	IBA	biological_process
GO:0030424	axon	IEA	cellular_component
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0045202	synapse	IEA	cellular_component
GO:0050839	cell adhesion molecule bi nding	IBA	molecular_function
GO:0004872	receptor activity	IBA	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0005913	cell-cell adherens juncti on	IBA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IBA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IBA	biological_process
GO:0008037	cell recognition	IBA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030424	axon	IEA	cellular_component
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0042995	cell projection	IEA	cellular_component
GO:0045202	synapse	IEA	cellular_component
GO:0045202	synapse	IEA	cellular_component
GO:0050839	cell adhesion molecule bi nding	IBA	molecular_function
GO:0004872	receptor activity	IBA	molecular_function
GO:0005102	receptor binding	IBA	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IBA	cellular_component
GO:0005913	cell-cell adherens juncti on	IBA	cellular_component
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	IBA	biological_process
GO:0007157	heterophilic cell-cell ad hesion via plasma membran e cell adhesion molecules	IBA	biological_process
GO:0008037	cell recognition	IBA	biological_process
GO:0034332	adherens junction organiz ation	TAS	biological_process
GO:0042803	protein homodimerization activity	IBA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IBA	molecular_function

Diseases

Associated diseases	References
Cancer	PMID: 22219177
Endometriosis	PMID: 22276910
Endometriosis	INFBASE22276910
Ulcerative colitis	PMID: 19861958

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22276910	Endometrio sis			100 (50 endomet riosis, 50 cont rols)		COX-2 BRAF NRAS CFL1 MAT2A SEPT9 ATAD3A CADM2 NAA15 and CCDC21	Show abstract