Endometriosis Knowledgebase

Search Result

Gene id

29766

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TMOD3 Gene UCSC Ensembl

Aliases

UTMOD

Gene name

tropomodulin 3

Alternate names

tropomodulin-3, tropomodulin 3 (ubiquitous), ubiquitous tropomodulin,

Gene location

15q21.2 (51829627: 51912137) Exons: 12 NC_000015.10

OMIM

605112

Protein Summary

Protein general information

Q9NYL9

Name: Tropomodulin 3 (Ubiquitous tropomodulin) (U Tmod)

Length: 352 Mass: 39,595

Tissue specificity: Ubiquitous. {ECO

Sequence

MALPFRKDLEKYKDLDEDELLGNLSETELKQLETVLDDLDPENALLPAGFRQKNQTSKSTTGPFDREHLLSYLEK
EALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELEEALTSASDTELCDLAAILGMHNLITNTKFC
NIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKDFAKALET
NTHVKCFSLAATRSNDPVATAFAEMLKVNKTLKSLNVESNFITGVGILALIDALRDNETLAELKIDNQRQQLGTA
VELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ

Structural information

Interpro:	IPR032675 IPR004934 IPR030133
Pfam:	PF03250
MINT:	1149880
STRING:	ENSP00000308753;

Other Databases

GeneCards: TMOD3; Malacards: TMOD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	IEA	molecular_function
GO:0005523	tropomyosin binding	IEA	molecular_function
GO:0005865	striated muscle thin fila ment	IBA	cellular_component
GO:0006936	muscle contraction	IBA	biological_process
GO:0007015	actin filament organizati on	IBA	biological_process
GO:0030239	myofibril assembly	IBA	biological_process
GO:0048821	erythrocyte development	IEA	biological_process
GO:0051694	pointed-end actin filamen t capping	IEA	biological_process
GO:1901992	positive regulation of mi totic cell cycle phase tr ansition	IEA	biological_process
GO:0003779	actin binding	IEA	molecular_function
GO:0005523	tropomyosin binding	IEA	molecular_function
GO:0005523	tropomyosin binding	IEA	molecular_function
GO:0005523	tropomyosin binding	TAS	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005865	striated muscle thin fila ment	IEA	cellular_component
GO:0005865	striated muscle thin fila ment	IBA	cellular_component
GO:0006936	muscle contraction	IBA	biological_process
GO:0007015	actin filament organizati on	IBA	biological_process
GO:0030036	actin cytoskeleton organi zation	IEA	biological_process
GO:0030036	actin cytoskeleton organi zation	IEA	biological_process
GO:0030239	myofibril assembly	IBA	biological_process
GO:0048821	erythrocyte development	IEA	biological_process
GO:0048821	erythrocyte development	IEA	biological_process
GO:0051694	pointed-end actin filamen t capping	IEA	biological_process
GO:1901992	positive regulation of mi totic cell cycle phase tr ansition	IEA	biological_process
GO:0005523	tropomyosin binding	TAS	molecular_function
GO:0005865	striated muscle thin fila ment	IBA	cellular_component
GO:0006936	muscle contraction	IBA	biological_process
GO:0007015	actin filament organizati on	IBA	biological_process
GO:0030239	myofibril assembly	IBA	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 22158085
Endometriosis	INFBASE22158085

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22158085	Endometrio sis			147 (35 early e ndometriosis, 5 5 advanced endo metriosis, 57 w ithout endometr iosis)		TMOD3	Show abstract