Search Result
| Gene id | 3630 | ||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary KEGG pathways Diseases PubMed references | |||||||||||||||||
Gene Summary |
|||||||||||||||||
| Gene Symbol | INS Gene UCSC Ensembl | ||||||||||||||||
| Aliases | IDDM, IDDM1, IDDM2, ILPR, IRDN, MODY10 | ||||||||||||||||
| Gene name | insulin | ||||||||||||||||
| Alternate names | insulin, preproinsulin, proinsulin, | ||||||||||||||||
| Gene location |
11p15.5 (2161208: 2159778) Exons: 3 NC_000011.10 |
||||||||||||||||
| Gene summary(Entrez) |
After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010] |
||||||||||||||||
| OMIM | 176730 | ||||||||||||||||
Protein Summary |
|||||||||||||||||
| Protein general information | P01308 Name: Insulin [Cleaved into: Insulin B chain; Insulin A chain] Length: 110 Mass: 11,981 | ||||||||||||||||
| Sequence |
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAG SLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN | ||||||||||||||||
| Structural information |
| ||||||||||||||||
| Other Databases | GeneCards: INS;  Malacards: INS | ||||||||||||||||
Gene ontology |
|||||||||||||||||
| |||||||||||||||||
KEGG pathways
|
|||||||||||||||||
|
hsa04940 Type I diabetes mellitus hsa04960 Aldosterone hsa04066 HIF-1 signaling pathway hsa04913 Ovarian steroidogenesis hsa04015 Rap1 signaling pathway hsa04213 Longevity regulating pathway hsa04072 Phospholipase D signaling pathway hsa04923 Regulation of lipolysis in adipocytes hsa04150 mTOR signaling pathway hsa04114 Oocyte meiosis hsa04950 Maturity onset diabetes of the young hsa04932 Non hsa04068 FoxO signaling pathway hsa04022 cGMP hsa04914 Progesterone hsa05215 Prostate cancer hsa04911 Insulin secretion hsa04152 AMPK signaling pathway hsa04910 Insulin signaling pathway hsa04140 Autophagy hsa04930 Type II diabetes mellitus hsa04810 Regulation of actin cytoskeleton hsa04014 Ras signaling pathway hsa04211 Longevity regulating pathway hsa04010 MAPK signaling pathway hsa04151 PI3K-Akt signaling pathway hsa04931 Insulin resistance hsa04917 Prolactin signaling pathway | |||||||||||||||||
Diseases
|
|||||||||||||||||
| |||||||||||||||||
PubMed references |
|||||||||||||||||
|
|||||||||||||||||