Search Result
| Gene id | 5599 | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary KEGG pathways Diseases PubMed references | |||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||
| Gene Symbol | MAPK8 Gene UCSC Ensembl | ||||||||||||||||||||
| Aliases | JNK, JNK-46, JNK1, JNK1A2, JNK21B1/2, PRKM8, SAPK1, SAPK1c | ||||||||||||||||||||
| Gene name | mitogen-activated protein kinase 8 | ||||||||||||||||||||
| Alternate names | mitogen-activated protein kinase 8, JUN N-terminal kinase, MAP kinase 8, c-Jun N-terminal kinase 1, mitogen-activated protein kinase 8 isoform JNK1 alpha1, mitogen-activated protein kinase 8 isoform JNK1 beta2, stress-activated protein kinase 1, stress-activated protein kinase 1c, | ||||||||||||||||||||
| Gene location |
10q11.22 (48306638: 48439359) Exons: 16 NC_000010.11 |
||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Apr 2016] |
||||||||||||||||||||
| OMIM | 601158 | ||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||
| Protein general information | P45983 Name: Mitogen-activated protein kinase 8 (MAP kinase 8) (MAPK 8) (EC 2.7.11.24) (JNK-46) (Stress-activated protein kinase 1c) (SAPK1c) (Stress-activated protein kinase JNK1) (c-Jun N-terminal kinase 1) Length: 427 Mass: 48,296 | ||||||||||||||||||||
| Sequence |
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELV LMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHR DLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILF PGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQ PSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR | ||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||
| Other Databases | GeneCards: MAPK8;  Malacards: MAPK8 | ||||||||||||||||||||
Gene ontology |
|||||||||||||||||||||
| |||||||||||||||||||||
KEGG pathways
|
|||||||||||||||||||||
|
hsa04621 NOD-like receptor signaling pathway hsa04622 RIG-I-like receptor signaling pathway hsa05120 Epithelial cell signaling in Helicobacter pylori infec hsa05210 Colorectal cancer hsa04210 Apoptosis hsa05133 Pertussis hsa04723 Retrograde endocannabinoid signaling hsa05212 Pancreatic cancer hsa05231 Choline metabolism in cancer hsa05131 Shigellosis hsa04141 Protein processing in endoplasmic reticulum hsa04722 Neurotrophin signaling pathway hsa04137 Mitophagy hsa05169 Epstein hsa04625 C-type lectin receptor signaling pathway hsa04664 Fc epsilon RI signaling pathway hsa04657 IL-17 signaling pathway hsa05132 Salmonella infection hsa04071 Sphingolipid signaling pathway hsa01522 Endocrine resistance hsa04215 Apoptosis hsa04530 Tight junction hsa04310 Wnt signaling pathway hsa04510 Focal adhesion hsa04912 GnRH signaling pathway hsa04620 Toll-like receptor signaling pathway hsa05418 Fluid shear stress and atherosclerosis hsa05170 Human immunodeficiency virus 1 infection hsa05160 Hepatitis C hsa04750 Inflammatory mediator regulation of TRP channels hsa05142 Chagas disease (American trypanosomiasis) hsa04926 Relaxin signaling pathway hsa05168 Herpes simplex infection hsa04932 Non hsa05145 Toxoplasmosis hsa04068 FoxO signaling pathway hsa04914 Progesterone hsa04024 cAMP signaling pathway hsa04910 Insulin signaling pathway hsa04140 Autophagy hsa04930 Type II diabetes mellitus hsa04668 TNF signaling pathway hsa04728 Dopaminergic synapse hsa04920 Adipocytokine signaling pathway hsa04012 ErbB signaling pathway hsa04014 Ras signaling pathway hsa04380 Osteoclast differentiation hsa04010 MAPK signaling pathway hsa05164 Influenza A hsa04217 Necroptosis hsa04933 AGE-RAGE signaling pathway in diabetic complications hsa05161 Hepatitis B hsa04931 Insulin resistance hsa05152 Tuberculosis hsa05167 Kaposi sarcoma hsa05200 Pathways in cancer hsa04659 Th17 cell differentiation hsa05166 Human T-cell leukemia virus 1 infection hsa04658 Th1 and Th2 cell differentiation hsa04917 Prolactin signaling pathway | |||||||||||||||||||||
Diseases
|
|||||||||||||||||||||
| |||||||||||||||||||||
PubMed references |
|||||||||||||||||||||
|
|||||||||||||||||||||