Endometriosis Knowledgebase

Search Result

Gene id

58985

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL22RA1 Gene UCSC Ensembl

Aliases

CRF2-9, IL22R, IL22R1

Gene name

interleukin 22 receptor subunit alpha 1

Alternate names

interleukin-22 receptor subunit alpha-1, IL-22 receptor subunit alpha-1, IL-22R-alpha-1, IL-22RA1, cytokine receptor class-II member 9, cytokine receptor family 2 member 9, interleukin 22 receptor, alpha 1, zcytoR11,

Gene location

1p36.11 (23835978: 24220610) Exons: 17 NC_000016.10

Gene summary(Entrez)

The protein encoded by this gene belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shared by the receptor complex for interleukin 10 (IL10). This gene and interleukin 28 receptor, alpha (IL28RA) form a cytokine receptor gene cluster in the chromosomal region 1p36. [provided by RefSeq, Jul 2008]

OMIM

605457

Protein Summary

Protein general information

Q8N6P7

Name: Interleukin-22 receptor subunit alpha-1 (IL-22 receptor subunit alpha-1) (IL-22R-alpha-1) (IL-22RA1) (Cytokine receptor class-II member 9) (Cytokine receptor family 2 member 9) (CRF2-9) (ZcytoR11)

Length: 574 Mass: 63,077

Tissue specificity: Expressed in colon, liver, lung, pancreas and kidney. No expression in immune cells such as monocytes, T-cells, and NK-cells. Expressed in keratinocytes of normal skin as well as in psoriatic skin lesion. Detected in normal blood brain

Sequence

MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRIT
RKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGD
GHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDR
TWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
YSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFP
FYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEV
TSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQ
GPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES

Structural information

Protein Domains	Fibronectin (17-124) Fibronectin (141-221)
Interpro:	IPR003961 IPR036116 IPR013783 IPR015373
Prosite:	PS50853
Pfam:	PF09294 PF01108
CDD:	cd00063
PDB:	3DGC 3DLQ
PDBsum:	3DGC 3DLQ
DIP:	42031
MINT:
STRING:	ENSP00000270800;

Other Databases

GeneCards: IL22RA1; Malacards: IL22RA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004904	interferon receptor activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0042015	interleukin-20 binding	IBA	molecular_function
GO:0050829	defense response to Gram- negative bacterium	IEA	biological_process
GO:0004904	interferon receptor activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0042015	interleukin-20 binding	IEA	molecular_function
GO:0042015	interleukin-20 binding	IBA	molecular_function
GO:0050829	defense response to Gram- negative bacterium	IEA	biological_process
GO:0004904	interferon receptor activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0016021	integral component of mem brane	IBA	cellular_component
GO:0042015	interleukin-20 binding	IBA	molecular_function

Diseases

Associated diseases	References
Celiac disease	PMID: 19240061
Endometriosis	PMID: 24133578
Endometriosis	INFBASE24133578
Rhinitis	PMID: 19393422

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24133578	Endometrio sis					IL-22 IL-22R1 IL-10R2)	Show abstract