Endometriosis Knowledgebase

Search Result

Gene id

59277

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NTN4 Gene UCSC Ensembl

Aliases

PRO3091

Gene name

netrin 4

Alternate names

netrin-4, beta-netrin, hepar-derived netrin-like protein,

Gene location

12q22 (95790757: 95657806) Exons: 10 NC_000012.12

Gene summary(Entrez)

This gene encodes a member of the netrin family of proteins, which function in various biological processes including axon guidance, tumorogenesis, and angiogenesis. Netrins are laminin-related proteins that have an N-terminal laminin-type domain, epidermal growth factor-like repeat domain, and a positively charged heparin-binding domain at the C-terminus. The protein encoded by this gene is involved in processes including neurite growth and migration, angiogenesis and mural cell adhesion to endothelial cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]

OMIM

610401

Protein Summary

Protein general information

Q9HB63

Name: Netrin 4 (Beta netrin) (Hepar derived netrin like protein)

Length: 628 Mass: 70,071

Tissue specificity: Expressed in kidney, spleen, mammary gland, aorta, heart, ovary, prostate and fetal spleen. {ECO

Sequence

MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDLTCRQP
KCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
GKTWKPYKYFATNCSATFGLEDDVVKKGAICTSKYSSPFPCTGGEVIFKALSPPYDTENPYSAKVQEQLKITNLR
VQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTA
GSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCDDCQHNTEGQYCQRCK
PGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPCKPGVAGRRCDRCMVGYWGFGDYGCRPCD
CAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYS
YVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKL
IVNMKSFVQHWKPSLGRKVMDILKRECK

Structural information

Protein Domains	Laminin (30-261) Laminin (262-331) Laminin (332-394) Laminin (395-448)
Interpro:	IPR008979 IPR002049 IPR008211 IPR001134 IPR018933 IPR008993
Prosite:	PS00022 PS01248 PS50027 PS51117 PS50189
Pfam:	PF00053 PF00055 PF01759
DIP:	46274
MINT:	1463888
STRING:	ENSP00000340998;

Other Databases

GeneCards: NTN4; Malacards: NTN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular_function
GO:0005604	basement membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007411	axon guidance	TAS	biological_process
GO:0016322	neuron remodeling	IEA	biological_process
GO:0043237	laminin-1 binding	IEA	molecular_function
GO:0060668	regulation of branching i nvolved in salivary gland morphogenesis by extrace llular matrix-epithelial cell signaling	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007411	axon guidance	TAS	biological_process
GO:0016322	neuron remodeling	IEA	biological_process
GO:0043237	laminin-1 binding	IEA	molecular_function
GO:0060668	regulation of branching i nvolved in salivary gland morphogenesis by extrace llular matrix-epithelial cell signaling	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007411	axon guidance	TAS	biological_process

KEGG pathways

hsa04360 Axon guidance

Diseases

Associated diseases	References
Cardiovascular disease	PMID: 17903304
Endometriosis	PMID: 24972566
Ovarian endometriosis	INFBASE24972566
Endometriosis	INFBASE24972566

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
24972566	Endometrio sis			60 (40 patients with ovarian endometriosis, 20 controls wit h benign ovaria n tumor)		NTN4 MIR20A	Show abstract