Endometriosis Knowledgebase

Search Result

Gene id

64793

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CEP85 Gene UCSC Ensembl

Aliases

CCDC21

Gene name

centrosomal protein 85

Alternate names

centrosomal protein of 85 kDa, centrosomal protein 85kDa, coiled-coil domain-containing protein 21,

Gene location

1p36.11 (26234152: 26278809) Exons: 16 NC_000001.11

Gene summary(Entrez)

This gene encodes a protein that belongs to the centrosome-associated family of proteins. The centrosome is a subcellular organelle in the animal cell that functions as a microtubule organizing center and is involved in cell-cycle progression. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Protein Summary

Protein general information

Q6P2H3

Name: Centrosomal protein of 85 kDa (Cep85) (Coiled coil domain containing protein 21)

Length: 762 Mass: 85,639

Sequence

MAMQEKYPTEGISHVTSPSSDVIQKGSSLGTEWQTPVISEPFRSRFSRCSSVADSGDTAIGTSCSDIAEDFCSSS
GSPPFQPIKSHVTIPTAHVMPSTLGTSPAKPNSTPVGPSSSKLPLSGLAESVGMTRNGDLGAMKHSPGLSRDLMY
FSGATGENGIEQSWFPAVGHERQEEARKFDIPSMESTLNQSAMMETLYSDPHHRVRFHNPRTSTSKELYRVLPEA
KKAPGSGAVFERNGPHSNSSGVLPLGLQPAPGLSKPLPSQVWQPSPDTWHPREQSCELSTCRQQLELIRLQMEQM
QLQNGAICHHPAAFGPSLPILEPAQWISILNSNEHLLKEKELLIDKQRKHISQLEQKVRESELQVHSALLGRPAP
FGDVCLLRLQELQRENTFLRAQFAQKTEALSREKIDLEKKLSASEVEVQLIRESLKVALQKHSEEVKKQEERVKG
RDKHINNLKKKCQKESEQNREKQQRIETLERYLADLPTLEDHQKQSQQLKDSELKSTELQEKVTELESLLEETQA
ICREKEIQLESLRQREAEFSSAGHSLQDKQSVEETSGEGPEVEMESWQKRYDSLQKIVEKQQQKMDQLRSQVQSL
EQEVAQEEGTSQALREEAQRRDSALQQLRTAVKELSVQNQDLIEKNLTLQEHLRQAQPGSPPSPDTAQLALELHQ
ELASCLQDLQAVCSIVTQRAQGHDPNLSLLLGIHSAQHPETQLDLQKPDVIKRKLEEVQQLRRDIEDLRTTMSDR
YAQDMGENCVTQ

Structural information

Interpro:	IPR029777
MINT:	7034519
STRING:	ENSP00000252992;

Other Databases

GeneCards: CEP85; Malacards: CEP85

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000242	pericentriolar material	IDA	cellular_component
GO:0000922	spindle pole	IDA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IMP	biological_process
GO:0007059	chromosome segregation	IEA	biological_process
GO:0046602	regulation of mitotic cen trosome separation	IMP	biological_process
GO:0000242	pericentriolar material	IDA	cellular_component
GO:0000922	spindle pole	IEA	cellular_component
GO:0000922	spindle pole	IDA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005730	nucleolus	IEA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005813	centrosome	IEA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005815	microtubule organizing ce nter	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IMP	biological_process
GO:0007059	chromosome segregation	IEA	biological_process
GO:0046602	regulation of mitotic cen trosome separation	IMP	biological_process
GO:0000242	pericentriolar material	IDA	cellular_component
GO:0000922	spindle pole	IDA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IMP	biological_process
GO:0046602	regulation of mitotic cen trosome separation	IMP	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 22276910
Endometriosis	INFBASE22276910

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22276910	Endometrio sis			100 (50 endomet riosis, 50 cont rols)		COX-2 BRAF NRAS CFL1 MAT2A SEPT9 ATAD3A CADM2 NAA15 and CCDC21	Show abstract