Endometriosis Knowledgebase

Search Result

Gene id

722

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

C4BPA Gene UCSC Ensembl

Aliases

C4BP, PRP

Gene name

complement component 4 binding protein alpha

Alternate names

C4b-binding protein alpha chain, proline-rich protein,

Gene location

1q32.2 (207104231: 207144971) Exons: 12 NC_000001.11

Gene summary(Entrez)

This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. [provided by RefSeq, Jul 2008]

OMIM

120830

Protein Summary

Protein general information

P04003

Name: C4b-binding protein alpha chain (C4bp) (Proline-rich protein) (PRP)

Length: 597 Mass: 67,033

Tissue specificity: Chylomicrons in the plasma.

Sequence

MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGT
TLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGST
TSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIG
VWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCI
NLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEI
TQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEI
IYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITC
SGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL

Structural information

Protein Domains	Sushi (49-110) Sushi (111-172) Sushi (173-236) Sushi (237-296) Sushi (297-362) Sushi (363-424) Sushi (425-482) Sushi (483-540)
Interpro:	IPR035976 IPR000436
Prosite:	PS50923
Pfam:	PF00084
CDD:	cd00033
PDB:	2A55 4B0F 5HYP 5HYT 5HYU 5HZP 5I0Q
PDBsum:	2A55 4B0F 5HYP 5HYT 5HYU 5HZP 5I0Q
STRING:	ENSP00000356037;

Other Databases

GeneCards: C4BPA; Malacards: C4BPA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006958	complement activation, cl assical pathway	IEA	biological_process
GO:0030449	regulation of complement activation	TAS	biological_process
GO:0044216	other organism cell	IDA	cellular_component
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045087	innate immune response	IEA	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IDA	biological_process
GO:0045959	negative regulation of co mplement activation, clas sical pathway	IDA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:1903027	regulation of opsonizatio n	IC	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006958	complement activation, cl assical pathway	IEA	biological_process
GO:0030449	regulation of complement activation	TAS	biological_process
GO:0044216	other organism cell	IDA	cellular_component
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045087	innate immune response	IEA	biological_process
GO:0045732	positive regulation of pr otein catabolic process	IDA	biological_process
GO:0045959	negative regulation of co mplement activation, clas sical pathway	IDA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:1903027	regulation of opsonizatio n	IC	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0030449	regulation of complement activation	TAS	biological_process
GO:0044216	other organism cell	IDA	cellular_component
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045732	positive regulation of pr otein catabolic process	IDA	biological_process
GO:0045959	negative regulation of co mplement activation, clas sical pathway	IDA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:1903027	regulation of opsonizatio n	IC	biological_process

KEGG pathways

hsa05133 Pertussis
hsa04610 Complement and coagulation cascades

Diseases

Associated diseases	References
Female infertility	INFBASE12810542
Implantation defects	INFBASE12810542
Endometriosis	INFBASE12810542

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12810542	Endometrio sis					IL-15 proline-rich protein B61 Dickkopf-1 glycodelin N-acetylglucosamine-6-O-sulfotransferase G0S2 protein purine nucleoside phosphorylase semaphorin E neuronal olfactomedin-related endoplasmic reticulum localized protein mRNA Sam68-like phospho	Show abstract