Search Result
| Gene id | 947 | ||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references | |||||||||||||||||
Gene Summary |
|||||||||||||||||
| Gene Symbol | CD34 Gene UCSC Ensembl | ||||||||||||||||
| Gene name | CD34 molecule | ||||||||||||||||
| Alternate names | hematopoietic progenitor cell antigen CD34, CD34 antigen, | ||||||||||||||||
| Gene location |
1q32.2 (207911337: 207886537) Exons: 8 NC_000001.11 |
||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
||||||||||||||||
| OMIM | 142230 | ||||||||||||||||
SNPs |
rs2276248 Strand: + Allele origin: unknown Allele change: C/T Mutation type: snp NC_000021.9 g.44259375T>C NC_000021.8 g.45679258T>C NM_013369.3 c.344+62A>G NM_175867.2 c.344+62A>G rs7354779 Strand: + Allele origin: unknown Allele change: C/T Mutation type: snp NC_000021.8 g.45670770T>C NC_000021.9 g.44250887T>C NM_013369.3 c.832A>G NR_135514.1 n.75T>C NP_787063.1 p.Arg278Gly NP_037501.2 p.Arg278Gly NM_175867.2 c.832A>G rs8129776 Strand: + Allele origin: unknown Allele change: A/G Mutation type: snp NC_000021.9 g.44249746G>A NC_000021.8 g.45669629G>A NM_013369.3 c.910-635C>T NR_135514.1 n.-1067G>A NM_175867.2 c.910-635C>T |
||||||||||||||||
Protein Summary |
|||||||||||||||||
| Protein general information | P28906 Name: Hematopoietic progenitor cell antigen CD34 (CD antigen CD34) Length: 385 Mass: 40,716 Tissue specificity: Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues. | ||||||||||||||||
| Sequence |
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPV SQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTS TSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG AQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGAL LAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSA RQHVVADTEL | ||||||||||||||||
| Structural information |
| ||||||||||||||||
| Other Databases | GeneCards: CD34;  Malacards: CD34 | ||||||||||||||||
Gene ontology |
|||||||||||||||||
| |||||||||||||||||
KEGG pathways
|
|||||||||||||||||
|
hsa04640 Hematopoietic cell lineage hsa04514 Cell adhesion molecules (CAMs) | |||||||||||||||||
Diseases
|
|||||||||||||||||
| |||||||||||||||||
PubMed references |
|||||||||||||||||
|
|||||||||||||||||