Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 100507436
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol MICA   Gene   UCSC   Ensembl
Aliases MIC-A, PERB11.1
Gene name MHC class I polypeptide-related sequence A
Alternate names MHC class I polypeptide-related sequence A, HLA class I antigen, MHC class I chain-related protein A, MHC class I related chain A, MHC class I related sequence A, stress inducible class I homolog, truncated MHC class I polypeptide-related sequence A,
Gene location 6p21.33 (31399783: 31415314)     Exons: 7     NC_000006.12
Gene summary(Entrez) This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. The protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2014]
OMIM 600169

Protein Summary

Protein general information Q29983  

Name: MHC class I polypeptide related sequence A (MIC A)

Length: 383  Mass: 42,915

Tissue specificity: Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's

Sequence MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAED
VLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEW
TMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTC
RASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKV
LVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLG
STGSTEGA
Structural information
Protein Domains
Ig-like (207-296)
Interpro:  IPR007110 IPR013783 IPR003597 IPR011161 IPR011162
Prosite:   PS50835

Pfam:  
PF07654 PF00129

PDB:  
1B3J 1HYR
PDBsum:   1B3J 1HYR

DIP:  
29681
MINT:   8214461
Other Databases GeneCards:  MICA;  Malacards:  MICA

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001913 T cell mediated cytotoxic
ity
IDA biological_process
GO:0002418 immune response to tumor
cell
IDA biological_process
GO:0003823 antigen binding
IBA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
IDA cellular_component
GO:0006974 cellular response to DNA
damage stimulus
IDA biological_process
GO:0009408 response to heat
IDA biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0016032 viral process
IEA biological_process
GO:0019835 cytolysis
IEA biological_process
GO:0019882 antigen processing and pr
esentation
IBA biological_process
GO:0032815 negative regulation of na
tural killer cell activat
ion
IDA biological_process
GO:0042267 natural killer cell media
ted cytotoxicity
IDA biological_process
GO:0042742 defense response to bacte
rium
IDA biological_process
GO:0042742 defense response to bacte
rium
IDA biological_process
GO:0045953 negative regulation of na
tural killer cell mediate
d cytotoxicity
IMP biological_process
GO:0046629 gamma-delta T cell activa
tion
IDA biological_process
GO:0046703 natural killer cell lecti
n-like receptor binding
IPI molecular_function
GO:0046703 natural killer cell lecti
n-like receptor binding
IDA molecular_function
GO:0050776 regulation of immune resp
onse
TAS biological_process
GO:0051607 defense response to virus
IDA biological_process
GO:0051607 defense response to virus
IDA biological_process
GO:0030881 beta-2-microglobulin bind
ing
IDA molecular_function
GO:0001913 T cell mediated cytotoxic
ity
IDA biological_process
GO:0002250 adaptive immune response
IEA biological_process
GO:0002376 immune system process
IEA biological_process
GO:0002418 immune response to tumor
cell
IDA biological_process
GO:0003823 antigen binding
IBA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
IDA cellular_component
GO:0006955 immune response
IEA biological_process
GO:0006974 cellular response to DNA
damage stimulus
IDA biological_process
GO:0009408 response to heat
IDA biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0016020 membrane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016032 viral process
IEA biological_process
GO:0019835 cytolysis
IEA biological_process
GO:0019882 antigen processing and pr
esentation
IBA biological_process
GO:0032815 negative regulation of na
tural killer cell activat
ion
IDA biological_process
GO:0042267 natural killer cell media
ted cytotoxicity
IDA biological_process
GO:0042742 defense response to bacte
rium
IDA biological_process
GO:0042742 defense response to bacte
rium
IDA biological_process
GO:0045953 negative regulation of na
tural killer cell mediate
d cytotoxicity
IMP biological_process
GO:0046629 gamma-delta T cell activa
tion
IDA biological_process
GO:0046703 natural killer cell lecti
n-like receptor binding
IPI molecular_function
GO:0046703 natural killer cell lecti
n-like receptor binding
IDA molecular_function
GO:0050776 regulation of immune resp
onse
TAS biological_process
GO:0051607 defense response to virus
IDA biological_process
GO:0051607 defense response to virus
IDA biological_process
GO:0030881 beta-2-microglobulin bind
ing
IDA molecular_function
GO:0001913 T cell mediated cytotoxic
ity
IDA biological_process
GO:0002418 immune response to tumor
cell
IDA biological_process
GO:0003823 antigen binding
IBA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005615 extracellular space
IDA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
IDA cellular_component
GO:0006974 cellular response to DNA
damage stimulus
IDA biological_process
GO:0009408 response to heat
IDA biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0009986 cell surface
IDA cellular_component
GO:0019882 antigen processing and pr
esentation
IBA biological_process
GO:0032815 negative regulation of na
tural killer cell activat
ion
IDA biological_process
GO:0042267 natural killer cell media
ted cytotoxicity
IDA biological_process
GO:0042742 defense response to bacte
rium
IDA biological_process
GO:0042742 defense response to bacte
rium
IDA biological_process
GO:0045953 negative regulation of na
tural killer cell mediate
d cytotoxicity
IMP biological_process
GO:0046629 gamma-delta T cell activa
tion
IDA biological_process
GO:0046703 natural killer cell lecti
n-like receptor binding
IPI molecular_function
GO:0046703 natural killer cell lecti
n-like receptor binding
IDA molecular_function
GO:0050776 regulation of immune resp
onse
TAS biological_process
GO:0051607 defense response to virus
IDA biological_process
GO:0051607 defense response to virus
IDA biological_process
GO:0030881 beta-2-microglobulin bind
ing
IDA molecular_function

KEGG pathways

hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04650  Natural killer cell mediated cytotoxicity

Diseases

Associated diseases References
Addison's disease PMID: 12392510
Alzheimer's disease PMID: 19691640
Amyloidosis PMID: 15018633
Ankylosing spondylitis PMID: 12118167
Asthma PMID: 16776673
Behcet's disease PMID: 12068141
Cancer PMID: 18951065
Cardiomyopathy PMID: 16101831
Celiac disease PMID: 15089901
Cleft lip PMID: 19594363
Crohn's disease PMID: 12392511
Diabetes PMID: 19820007
Endometriosis PMID: 25775242
Graves disease PMID: 17221346
Idiopathic pulmonary fibrosis PMID: 19363685
Multiple sclerosis PMID: 18588574
Endometriosis INFBASE25775242
Polyendocrinopathies PMID: 18390988
Polymyositis PMID: 15022353
Psoriasis PMID: 18799098
Recurrent miscarriage PMID: 15304010
Rheumatoid arthritis PMID: 15077289
Spondyloarthropathies PMID: 16720212
Stevens-Johnson syndrome PMID: 21801394
Systemic lupus erythematosus PMID: 15522921
Ulcerative colitis PMID: 16116311

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
25775242 Endometrio
sis

202 (121 women
with histologic
ally proven end
ometriosis, 81
endometriosis-f
ree controls )
MICB
MICA
ULBP2
Show abstract