Endometriosis Knowledgebase

Search Result

Gene id

10140

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TOB1 Gene UCSC Ensembl

Aliases

APRO5, APRO6, PIG49, TOB, TROB, TROB1

Gene name

transducer of ERBB2, 1

Alternate names

protein Tob1, proliferation-inducing gene 49, transducer of erbB-2 1,

Gene location

17q21.33 (50867977: 50862222) Exons: 4 NC_000017.11

Gene summary(Entrez)

This gene encodes a member of the transducer of erbB-2 /B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The encoded protein may function as a tumor suppressor. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

OMIM

605523

Protein Summary

Protein general information

P50616

Name: Protein Tob1 (Transducer of erbB 2 1)

Length: 345 Mass: 38,155

Tissue specificity: Ubiquitous.

Sequence

MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKES
GLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVS
SSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSS
MHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSP
LQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN

Structural information

Motifs	Bipartite nuclear(22-39) Nuclear export(226-234)
Interpro:	IPR002087 IPR015677 IPR015676
Prosite:	PS00960 PS01203
Pfam:	PF07742
PDB:	2D5R 2Z15 5CI8 5CI9
PDBsum:	2D5R 2Z15 5CI8 5CI9
MINT:	1384463
STRING:	ENSP00000268957;

Other Databases

GeneCards: TOB1; Malacards: TOB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003714	transcription corepressor activity	IEA	molecular_function
GO:0005070	SH3/SH2 adaptor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0007184	SMAD protein import into nucleus	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009967	positive regulation of si gnal transduction	IEA	biological_process
GO:0017148	negative regulation of tr anslation	IDA	biological_process
GO:0030014	CCR4-NOT complex	IDA	cellular_component
GO:0030514	negative regulation of BM P signaling pathway	IEA	biological_process
GO:0030971	receptor tyrosine kinase binding	IDA	molecular_function
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0046332	SMAD binding	IEA	molecular_function
GO:0060212	negative regulation of nu clear-transcribed mRNA po ly(A) tail shortening	IDA	biological_process
GO:0060213	positive regulation of nu clear-transcribed mRNA po ly(A) tail shortening	IDA	biological_process
GO:1900153	positive regulation of nu clear-transcribed mRNA ca tabolic process, deadenyl ation-dependent decay	IDA	biological_process
GO:1903507	negative regulation of nu cleic acid-templated tran scription	IEA	biological_process
GO:0003714	transcription corepressor activity	IEA	molecular_function
GO:0005070	SH3/SH2 adaptor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0007184	SMAD protein import into nucleus	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0009967	positive regulation of si gnal transduction	IEA	biological_process
GO:0017148	negative regulation of tr anslation	IDA	biological_process
GO:0030014	CCR4-NOT complex	IDA	cellular_component
GO:0030514	negative regulation of BM P signaling pathway	IEA	biological_process
GO:0030971	receptor tyrosine kinase binding	IDA	molecular_function
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0046332	SMAD binding	IEA	molecular_function
GO:0060212	negative regulation of nu clear-transcribed mRNA po ly(A) tail shortening	IDA	biological_process
GO:0060213	positive regulation of nu clear-transcribed mRNA po ly(A) tail shortening	IDA	biological_process
GO:1900153	positive regulation of nu clear-transcribed mRNA ca tabolic process, deadenyl ation-dependent decay	IDA	biological_process
GO:1903507	negative regulation of nu cleic acid-templated tran scription	IEA	biological_process
GO:0005070	SH3/SH2 adaptor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0017148	negative regulation of tr anslation	IDA	biological_process
GO:0030014	CCR4-NOT complex	IDA	cellular_component
GO:0030971	receptor tyrosine kinase binding	IDA	molecular_function
GO:0060212	negative regulation of nu clear-transcribed mRNA po ly(A) tail shortening	IDA	biological_process
GO:0060213	positive regulation of nu clear-transcribed mRNA po ly(A) tail shortening	IDA	biological_process
GO:1900153	positive regulation of nu clear-transcribed mRNA ca tabolic process, deadenyl ation-dependent decay	IDA	biological_process

KEGG pathways

hsa03018 RNA degradation

Diseases

Associated diseases	References
Endometriosis	PMID: 12372467
Endometriosis	INFBASE12372467

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12372467	Endometrio sis					Tob-1 IL-1beta	Show abstract