Endometriosis Knowledgebase

Search Result

Gene id

10253

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

SPRY2 Gene UCSC Ensembl

Aliases

IGAN3, hSPRY2

Gene name

sprouty RTK signaling antagonist 2

Alternate names

protein sprouty homolog 2,

Gene location

13q31.1 (75721327: 75757818) Exons: 43 NC_000017.11

Gene summary(Entrez)

This gene encodes a protein belonging to the sprouty family. The encoded protein contains a carboxyl-terminal cysteine-rich domain essential for the inhibitory activity on receptor tyrosine kinase signaling proteins and is required for growth factor stimulated translocation of the protein to membrane ruffles. In primary dermal endothelial cells this gene is transiently upregulated in response to fibroblast growth factor two. This protein is indirectly involved in the non-cell autonomous inhibitory effect on fibroblast growth factor two signaling. The protein interacts with Cas-Br-M (murine) ectropic retroviral transforming sequence, and can function as a bimodal regulator of epidermal growth factor receptor/mitogen-activated protein kinase signaling. This protein may play a role in alveoli branching during lung development as shown by a similar mouse protein. [provided by RefSeq, Jul 2008]

OMIM

602466

Protein Summary

Protein general information

O43597

Name: Protein sprouty homolog 2 (Spry-2)

Length: 315 Mass: 34,688

Sequence

MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPAPRPST
QHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGSSFSSGPVADGII
RVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGL
FYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
CKVPTVPPRNFEKPT

Structural information

Protein Domains	SPR. (177-291)
Interpro:	IPR007875 IPR030780
Prosite:	PS51227
Pfam:	PF05210
PDB:	3BUM 3OB1 5HKY 5HKZ 5HL0
PDBsum:	3BUM 3OB1 5HKY 5HKZ 5HL0
MINT:
STRING:	ENSP00000366306;

Other Databases

GeneCards: SPRY2; Malacards: SPRY2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000132	establishment of mitotic spindle orientation	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005829	cytosol	ISS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	ISS	cellular_component
GO:0005874	microtubule	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007605	sensory perception of sou nd	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010801	negative regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0016020	membrane	ISS	cellular_component
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030291	protein serine/threonine kinase inhibitor activity	IC	molecular_function
GO:0031345	negative regulation of ce ll projection organizatio n	ISS	biological_process
GO:0032587	ruffle membrane	IEA	cellular_component
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IMP	biological_process
GO:0034260	negative regulation of GT Pase activity	IEA	biological_process
GO:0040037	negative regulation of fi broblast growth factor re ceptor signaling pathway	IEA	biological_process
GO:0042059	negative regulation of ep idermal growth factor rec eptor signaling pathway	TAS	biological_process
GO:0042472	inner ear morphogenesis	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043407	negative regulation of MA P kinase activity	IEA	biological_process
GO:0043539	protein serine/threonine kinase activator activity	IMP	molecular_function
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045595	regulation of cell differ entiation	IEA	biological_process
GO:0046580	negative regulation of Ra s protein signal transduc tion	IEA	biological_process
GO:0051387	negative regulation of ne urotrophin TRK receptor s ignaling pathway	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0060437	lung growth	IEA	biological_process
GO:0060449	bud elongation involved i n lung branching	IEA	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IEA	biological_process
GO:0000132	establishment of mitotic spindle orientation	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	ISS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	ISS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005874	microtubule	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007605	sensory perception of sou nd	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009966	regulation of signal tran sduction	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010801	negative regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	ISS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030291	protein serine/threonine kinase inhibitor activity	IC	molecular_function
GO:0030324	lung development	IEA	biological_process
GO:0031345	negative regulation of ce ll projection organizatio n	IEA	biological_process
GO:0031345	negative regulation of ce ll projection organizatio n	ISS	biological_process
GO:0032587	ruffle membrane	IEA	cellular_component
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IMP	biological_process
GO:0034260	negative regulation of GT Pase activity	IEA	biological_process
GO:0040037	negative regulation of fi broblast growth factor re ceptor signaling pathway	IEA	biological_process
GO:0042059	negative regulation of ep idermal growth factor rec eptor signaling pathway	TAS	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042472	inner ear morphogenesis	IEA	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043407	negative regulation of MA P kinase activity	IEA	biological_process
GO:0043539	protein serine/threonine kinase activator activity	IMP	molecular_function
GO:0045165	cell fate commitment	IEA	biological_process
GO:0045595	regulation of cell differ entiation	IEA	biological_process
GO:0046580	negative regulation of Ra s protein signal transduc tion	IEA	biological_process
GO:0046580	negative regulation of Ra s protein signal transduc tion	IEA	biological_process
GO:0048754	branching morphogenesis o f an epithelial tube	IEA	biological_process
GO:0051387	negative regulation of ne urotrophin TRK receptor s ignaling pathway	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0060425	lung morphogenesis	IEA	biological_process
GO:0060437	lung growth	IEA	biological_process
GO:0060449	bud elongation involved i n lung branching	IEA	biological_process
GO:0060541	respiratory system develo pment	IEA	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0071902	positive regulation of pr otein serine/threonine ki nase activity	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	ISS	cellular_component
GO:0005829	cytosol	ISS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	ISS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010801	negative regulation of pe ptidyl-threonine phosphor ylation	IDA	biological_process
GO:0016020	membrane	ISS	cellular_component
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030291	protein serine/threonine kinase inhibitor activity	IC	molecular_function
GO:0031345	negative regulation of ce ll projection organizatio n	ISS	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IMP	biological_process
GO:0042059	negative regulation of ep idermal growth factor rec eptor signaling pathway	TAS	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043539	protein serine/threonine kinase activator activity	IMP	molecular_function
GO:0051897	positive regulation of pr otein kinase B signaling	IMP	biological_process
GO:0070373	negative regulation of ER K1 and ERK2 cascade	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process

Diseases

Associated diseases	References
Cleft lip with cleft palate	PMID: 16327884
Endometriosis	PMID: 15299092
Kidney failure	PMID: 21085059
Ovarian endometriosis	INFBASE16815388
Endometriosis	INFBASE15299092
Neurofibromatosis 1	PMID: 19443465
Ovarian endometriosis	PMID: 16815388

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15299092	Endometrio sis				Female infertility	PDGFRA PKC beta1 JAK1 Sprouty2 MKK7 COUP-TF2 PGE2EP	Show abstract
16815388	Endometrio sis (ovari an)				Female infertility	PDGFRA PKCbeta1 JAK1 HSP90A COUP-TF2 MOR 17betaHSD2 Sprouty2 and PGE(2)EP3	Show abstract