Endometriosis Knowledgebase

Search Result

Gene id

10257

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ABCC4 Gene UCSC Ensembl

Aliases

MOAT-B, MOATB, MRP4

Gene name

ATP binding cassette subfamily C member 4

Alternate names

multidrug resistance-associated protein 4, MRP/cMOAT-related ABC transporter, bA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4), canalicular multispecific organic anion transporter (ABC superfamily), multi-specific organic anion transporter ,

Gene location

13q32.1 (95301549: 95019828) Exons: 36 NC_000013.11

Gene summary(Entrez)

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This family member plays a role in cellular detoxification as a pump for its substrate, organic anions. It may also function in prostaglandin-mediated cAMP signaling in ciliogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014]

OMIM

605250

Protein Summary

Protein general information

O15439

Name: Multidrug resistance associated protein 4 (ATP binding cassette sub family C member 4) (MRP/cMOAT related ABC transporter) (Multi specific organic anion transporter B) (MOAT B)

Length: 1325 Mass: 149,527

Tissue specificity: Widely expressed, with particularly high levels in prostate, but is barely detectable in liver.

Sequence

MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDA
QKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQPIFLGKIINYFENYDPMDSVALNTAYAYATVLTFCTLILAI
LHHLYFYHVQCAGMRLRVAMCHMIYRKALRLSNMAMGKTTTGQIVNLLSNDVNKFDQVTVFLHFLWAGPLQAIAV
TALLWMEIGISCLAGMAVLIILLPLQSCFGKLFSSLRSKTATFTDARIRTMNEVITGIRIIKMYAWEKSFSNLIT
NLRKKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASRVFVAVTLYGAVRLTVTLFFPSAIER
VSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWDKASETPTLQGLSFTVRPGELLAVVGPVGAG
KSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDL
TVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAA
SQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALE
SQDTENVPVTLSEENRSEGKVGFQAYKNYFRAGAHWIVFIFLILLNTAAQVAYVLQDWWLSYWANKQSMLNVTVN
GGGNVTEKLDLNWYLGIYSGLTVATVLFGIARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPIGRILNRF
SKDIGHLDDLLPLTFLDFIQTLLQVVGVVSVAVAVIPWIAIPLVPLGIIFIFLRRYFLETSRDVKRLESTTRSPV
FSHLSSSLQGLWTIRAYKAEERCQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAMFVIIVAFGSLILAKTLD
AGQVGLALSYALTLMGMFQWCVRQSAEVENMMISVERVIEYTDLEKEAPWEYQKRPPPAWPHEGVIIFDNVNFMY
SPGGPLVLKHLTALIKSQEKVGIVGRTGAGKSSLISALFRLSEPEGKIWIDKILTTEIGLHDLRKKMSIIPQEPV
LFTGTMRKNLDPFNEHTDEELWNALQEVQLKETIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILRKNQILII
DEATANVDPRTDELIQKKIREKFAHCTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQ
LGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPSTLTIFETAL

Structural information

Protein Domains	ABC (92-377) ABC (410-633) ABC (714-1005) (1041-)
Motifs	PDZ-binding. (1322-1325)
Interpro:	IPR003593 IPR011527 IPR003439 IPR017871 IPR030240 IPR027417
Prosite:	PS50929 PS00211 PS50893
Pfam:	PF00664 PF00005
STRING:	ENSP00000366084;

Other Databases

GeneCards: ABCC4; Malacards: ABCC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005524	ATP binding	IEA	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0015662	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism	TAS	molecular_function
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	NAS	molecular_function
GO:0031088	platelet dense granule me mbrane	IDA	cellular_component
GO:0031088	platelet dense granule me mbrane	TAS	cellular_component
GO:0032310	prostaglandin secretion	IDA	biological_process
GO:0043225	ATPase-coupled anion tran smembrane transporter act ivity	TAS	molecular_function
GO:0055085	transmembrane transport	TAS	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0098656	anion transmembrane trans port	IEA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006810	transport	IEA	biological_process
GO:0006810	transport	IEA	biological_process
GO:0008150	biological_process	ND	biological_process
GO:0015662	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	NAS	molecular_function
GO:0016887	ATPase activity	IEA	molecular_function
GO:0031088	platelet dense granule me mbrane	IDA	cellular_component
GO:0031088	platelet dense granule me mbrane	TAS	cellular_component
GO:0032310	prostaglandin secretion	IDA	biological_process
GO:0034220	ion transmembrane transpo rt	IEA	biological_process
GO:0042626	ATPase activity, coupled to transmembrane movement of substances	IEA	molecular_function
GO:0043225	ATPase-coupled anion tran smembrane transporter act ivity	TAS	molecular_function
GO:0055085	transmembrane transport	IEA	biological_process
GO:0055085	transmembrane transport	TAS	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0098656	anion transmembrane trans port	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0015662	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism	TAS	molecular_function
GO:0016020	membrane	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016323	basolateral plasma membra ne	IDA	cellular_component
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	NAS	molecular_function
GO:0031088	platelet dense granule me mbrane	IDA	cellular_component
GO:0031088	platelet dense granule me mbrane	TAS	cellular_component
GO:0032310	prostaglandin secretion	IDA	biological_process
GO:0043225	ATPase-coupled anion tran smembrane transporter act ivity	TAS	molecular_function
GO:0055085	transmembrane transport	TAS	biological_process

KEGG pathways

hsa04024  cAMP signaling pathway
hsa04976  Bile secretion
hsa01523  Antifolate resistance
hsa02010  ABC transporters

Diseases

Associated diseases	References
Cancer	PMID: 19696793
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Endometriosis	PMID: 25446850
Endometriosis	PMID: 26240828
Kidney disease	PMID: 17083032
Endometriosis	INFBASE25446850

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25446850	Endometrio sis				Female infertility	PGF2A AKR1B1 AKR1C3 PLA2G2A PTGS2/COX-2 ABCC4 and PTGFR PLA2G4A and HPGD	Show abstract
26240828	Endometrio sis		108	108 (78 with en dometriosis, 30 healthy contro l subjects)	Female infertility	EP3 EP4 FP PGT MRP4	Show abstract