Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 1027
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CDKN1B   Gene   UCSC   Ensembl
Aliases CDKN4, KIP1, MEN1B, MEN4, P27KIP1
Gene name cyclin dependent kinase inhibitor 1B
Alternate names cyclin-dependent kinase inhibitor 1B, cyclin-dependent kinase inhibitor 1B (p27, Kip1),
Gene location 12p13.1 (12717269: 12722382)     Exons: 3     NC_000012.12
Gene summary(Entrez) This gene encodes a cyclin-dependent kinase inhibitor, which shares a limited similarity with CDK inhibitor CDKN1A/p21. The encoded protein binds to and prevents the activation of cyclin E-CDK2 or cyclin D-CDK4 complexes, and thus controls the cell cycle progression at G1. The degradation of this protein, which is triggered by its CDK dependent phosphorylation and subsequent ubiquitination by SCF complexes, is required for the cellular transition from quiescence to the proliferative state. Mutations in this gene are associated with multiple endocrine neoplasia type IV (MEN4). [provided by RefSeq, Apr 2014]
OMIM 600778

Protein Summary

Protein general information P46527  

Name: Cyclin dependent kinase inhibitor 1B (Cyclin dependent kinase inhibitor p27) (p27Kip1)

Length: 198  Mass: 22,073

Tissue specificity: Expressed in all tissues tested. Highest levels in skeletal muscle, lowest in liver and kidney.

Sequence MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYE
WQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAG
IRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
Structural information

Motifs
Nuclear localization(153-169)
Interpro:  IPR003175 IPR029843

Pfam:  
PF02234

PDB:  
1H27 1JSU 2AST
PDBsum:   1H27 1JSU 2AST

DIP:  
33341
MINT:   239177
STRING:   ENSP00000228872;
Other Databases GeneCards:  CDKN1B;  Malacards:  CDKN1B

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000079 regulation of cyclin-depe
ndent protein serine/thre
onine kinase activity
TAS biological_process
GO:0000082 G1/S transition of mitoti
c cell cycle
IDA biological_process
GO:0000082 G1/S transition of mitoti
c cell cycle
TAS biological_process
GO:0001666 response to hypoxia
IEA biological_process
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
TAS molecular_function
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
TAS molecular_function
GO:0005072 transforming growth facto
r beta receptor, cytoplas
mic mediator activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005768 endosome
IEA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006813 potassium ion transport
IEA biological_process
GO:0006919 activation of cysteine-ty
pe endopeptidase activity
involved in apoptotic pr
ocess
IDA biological_process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
TAS biological_process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
TAS biological_process
GO:0007050 cell cycle arrest
IMP biological_process
GO:0007219 Notch signaling pathway
IEA biological_process
GO:0007605 sensory perception of sou
nd
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IEA biological_process
GO:0008285 negative regulation of ce
ll proliferation
IDA biological_process
GO:0008285 negative regulation of ce
ll proliferation
IMP biological_process
GO:0009749 response to glucose
IEA biological_process
GO:0010942 positive regulation of ce
ll death
IDA biological_process
GO:0019903 protein phosphatase bindi
ng
IPI molecular_function
GO:0030308 negative regulation of ce
ll growth
IDA biological_process
GO:0030544 Hsp70 protein binding
IEA molecular_function
GO:0031116 positive regulation of mi
crotubule polymerization
IEA biological_process
GO:0031464 Cul4A-RING E3 ubiquitin l
igase complex
IDA cellular_component
GO:0032355 response to estradiol
IEA biological_process
GO:0032403 protein complex binding
IEA molecular_function
GO:0033673 negative regulation of ki
nase activity
IDA biological_process
GO:0042326 negative regulation of ph
osphorylation
IDA biological_process
GO:0042493 response to drug
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
IEA biological_process
GO:0043200 response to amino acid
IEA biological_process
GO:0043434 response to peptide hormo
ne
IEA biological_process
GO:0045732 positive regulation of pr
otein catabolic process
IDA biological_process
GO:0045736 negative regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
IEA biological_process
GO:0045737 positive regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
IEA biological_process
GO:0045787 positive regulation of ce
ll cycle
TAS biological_process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IDA biological_process
GO:0045930 negative regulation of mi
totic cell cycle
IDA biological_process
GO:0046686 response to cadmium ion
IEA biological_process
GO:0048102 autophagic cell death
IDA biological_process
GO:0048839 inner ear development
IEA biological_process
GO:0051087 chaperone binding
IEA molecular_function
GO:0051271 negative regulation of ce
llular component movement
IEA biological_process
GO:0060770 negative regulation of ep
ithelial cell proliferati
on involved in prostate g
land development
IEA biological_process
GO:0071236 cellular response to anti
biotic
IEA biological_process
GO:0071285 cellular response to lith
ium ion
IDA biological_process
GO:0071407 cellular response to orga
nic cyclic compound
IEA biological_process
GO:0071850 mitotic cell cycle arrest
IDA biological_process
GO:1904706 negative regulation of va
scular smooth muscle cell
proliferation
IMP biological_process
GO:0008656 cysteine-type endopeptida
se activator activity inv
olved in apoptotic proces
s
IDA molecular_function
GO:0000079 regulation of cyclin-depe
ndent protein serine/thre
onine kinase activity
TAS biological_process
GO:0000082 G1/S transition of mitoti
c cell cycle
IEA biological_process
GO:0000082 G1/S transition of mitoti
c cell cycle
IDA biological_process
GO:0000082 G1/S transition of mitoti
c cell cycle
TAS biological_process
GO:0001666 response to hypoxia
IEA biological_process
GO:0004860 protein kinase inhibitor
activity
IEA molecular_function
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
IEA molecular_function
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
IEA molecular_function
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
TAS molecular_function
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
TAS molecular_function
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
TAS molecular_function
GO:0005072 transforming growth facto
r beta receptor, cytoplas
mic mediator activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005768 endosome
IEA cellular_component
GO:0005768 endosome
IEA cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006813 potassium ion transport
IEA biological_process
GO:0006919 activation of cysteine-ty
pe endopeptidase activity
involved in apoptotic pr
ocess
IDA biological_process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
TAS biological_process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
TAS biological_process
GO:0007049 cell cycle
IEA biological_process
GO:0007050 cell cycle arrest
IEA biological_process
GO:0007050 cell cycle arrest
IEA biological_process
GO:0007050 cell cycle arrest
IMP biological_process
GO:0007219 Notch signaling pathway
IEA biological_process
GO:0007605 sensory perception of sou
nd
IEA biological_process
GO:0008219 cell death
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IEA biological_process
GO:0008285 negative regulation of ce
ll proliferation
IEA biological_process
GO:0008285 negative regulation of ce
ll proliferation
IDA biological_process
GO:0008285 negative regulation of ce
ll proliferation
IMP biological_process
GO:0009749 response to glucose
IEA biological_process
GO:0010942 positive regulation of ce
ll death
IDA biological_process
GO:0014070 response to organic cycli
c compound
IEA biological_process
GO:0019903 protein phosphatase bindi
ng
IPI molecular_function
GO:0030308 negative regulation of ce
ll growth
IDA biological_process
GO:0030544 Hsp70 protein binding
IEA molecular_function
GO:0031116 positive regulation of mi
crotubule polymerization
IEA biological_process
GO:0031464 Cul4A-RING E3 ubiquitin l
igase complex
IDA cellular_component
GO:0032355 response to estradiol
IEA biological_process
GO:0032403 protein complex binding
IEA molecular_function
GO:0033673 negative regulation of ki
nase activity
IDA biological_process
GO:0042127 regulation of cell prolif
eration
IEA biological_process
GO:0042326 negative regulation of ph
osphorylation
IDA biological_process
GO:0042493 response to drug
IEA biological_process
GO:0043066 negative regulation of ap
optotic process
IEA biological_process
GO:0043200 response to amino acid
IEA biological_process
GO:0043234 protein complex
IEA cellular_component
GO:0043434 response to peptide hormo
ne
IEA biological_process
GO:0045732 positive regulation of pr
otein catabolic process
IDA biological_process
GO:0045736 negative regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
IEA biological_process
GO:0045737 positive regulation of cy
clin-dependent protein se
rine/threonine kinase act
ivity
IEA biological_process
GO:0045787 positive regulation of ce
ll cycle
TAS biological_process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IDA biological_process
GO:0045930 negative regulation of mi
totic cell cycle
IDA biological_process
GO:0046686 response to cadmium ion
IEA biological_process
GO:0048102 autophagic cell death
IDA biological_process
GO:0048839 inner ear development
IEA biological_process
GO:0050680 negative regulation of ep
ithelial cell proliferati
on
IEA biological_process
GO:0051087 chaperone binding
IEA molecular_function
GO:0051271 negative regulation of ce
llular component movement
IEA biological_process
GO:0060770 negative regulation of ep
ithelial cell proliferati
on involved in prostate g
land development
IEA biological_process
GO:0071236 cellular response to anti
biotic
IEA biological_process
GO:0071285 cellular response to lith
ium ion
IDA biological_process
GO:0071407 cellular response to orga
nic cyclic compound
IEA biological_process
GO:0071850 mitotic cell cycle arrest
IDA biological_process
GO:1904706 negative regulation of va
scular smooth muscle cell
proliferation
IMP biological_process
GO:0008656 cysteine-type endopeptida
se activator activity inv
olved in apoptotic proces
s
IDA molecular_function
GO:0000079 regulation of cyclin-depe
ndent protein serine/thre
onine kinase activity
TAS biological_process
GO:0000082 G1/S transition of mitoti
c cell cycle
IDA biological_process
GO:0000082 G1/S transition of mitoti
c cell cycle
TAS biological_process
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
TAS molecular_function
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
TAS molecular_function
GO:0004861 cyclin-dependent protein
serine/threonine kinase i
nhibitor activity
TAS molecular_function
GO:0005072 transforming growth facto
r beta receptor, cytoplas
mic mediator activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006919 activation of cysteine-ty
pe endopeptidase activity
involved in apoptotic pr
ocess
IDA biological_process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
TAS biological_process
GO:0006977 DNA damage response, sign
al transduction by p53 cl
ass mediator resulting in
cell cycle arrest
TAS biological_process
GO:0007050 cell cycle arrest
IMP biological_process
GO:0008285 negative regulation of ce
ll proliferation
IDA biological_process
GO:0008285 negative regulation of ce
ll proliferation
IMP biological_process
GO:0010942 positive regulation of ce
ll death
IDA biological_process
GO:0019903 protein phosphatase bindi
ng
IPI molecular_function
GO:0030308 negative regulation of ce
ll growth
IDA biological_process
GO:0031464 Cul4A-RING E3 ubiquitin l
igase complex
IDA cellular_component
GO:0033673 negative regulation of ki
nase activity
IDA biological_process
GO:0042326 negative regulation of ph
osphorylation
IDA biological_process
GO:0045732 positive regulation of pr
otein catabolic process
IDA biological_process
GO:0045787 positive regulation of ce
ll cycle
TAS biological_process
GO:0045892 negative regulation of tr
anscription, DNA-template
d
IDA biological_process
GO:0045930 negative regulation of mi
totic cell cycle
IDA biological_process
GO:0048102 autophagic cell death
IDA biological_process
GO:0071285 cellular response to lith
ium ion
IDA biological_process
GO:0071850 mitotic cell cycle arrest
IDA biological_process
GO:1904706 negative regulation of va
scular smooth muscle cell
proliferation
IMP biological_process
GO:0008656 cysteine-type endopeptida
se activator activity inv
olved in apoptotic proces
s
IDA molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa05169  Epstein-Barr virus infection
hsa05161  Hepatitis B
hsa04068  FoxO signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa05162  Measles
hsa04066  HIF-1 signaling pathway
hsa04110  Cell cycle
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa04012  ErbB signaling pathway

Diseases

Associated diseases References
Cancer PMID: 19817957
Chronic obstructive pulmonary disease (COPD) PMID: 19625176
Endometrial cancer PMID: 21454826
Endometriosis PMID: 18321488
Multiple endocrine neoplasia syndrome KEGG: H00247, OMIM: 600778
Myocardial infarction PMID: 15061869
Peritoneal endometriosis PMID: 11334908
Peritoneal endometriosis PMID: 11334908
Pituitary adenoma KEGG: H01102
Premature ovarian failure ( POF) PMID: 21575944
Primary hyperparathyroidism PMID: 19474519
Prostate cancer KEGG: H00024
Endometriosis INFBASE18321488
Peritoneal endometriosis INFBASE11334908

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
18321488 Endometrio
sis

24 (13 patients
with stage I/I
I endometriosis
, 5 with stage
III/IV endometr
iosis, 11 contr
ol subjects)
P27Kip1
Show abstract
11334908 Endometrio
sis (Perit
oneal)

31 patients wit
h peritoneal en
dometriosis
p27Kip1
Show abstract