Endometriosis Knowledgebase

Search Result

Gene id

1029

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CDKN2A Gene UCSC Ensembl

Aliases

ARF, CDK4I, CDKN2, CMM2, INK4, INK4A, MLM, MTS-1, MTS1, P14, P14ARF, P16, P16-INK4A, P16INK4, P16INK4A, P19, P19ARF, TP16

Gene name

cyclin dependent kinase inhibitor 2A

Alternate names

cyclin-dependent kinase inhibitor 2A, CDK4 inhibitor p16-INK4, alternative reading frame, cell cycle negative regulator beta, cyclin-dependent kinase 4 inhibitor A, cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4), multiple tumor suppressor 1,

Gene location

9p21.3 (21995042: 21967751) Exons: 8 NC_000009.12

Gene summary(Entrez)

This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, the E3 ubiquitin-protein ligase MDM2, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene. [provided by RefSeq, Sep 2012]

OMIM

600160

SNPs

rs3731197

Strand:    Allele origin:   Allele change: A/G   Mutation type: snp

CM000671.2   g.21991372C>T
NC_000009.11   g.21991371C>T
NC_000009.12   g.21991372C>T
NG_007485.1   g.8120G>A
NM_058195.3   c.193+2767G>A
XR_242496.1   n.347+2767G>A

Protein Summary

Protein general information

P42771

Name: Cyclin dependent kinase inhibitor 2A (Cyclin dependent kinase 4 inhibitor A) (CDK4I) (Multiple tumor suppressor 1) (MTS 1) (p16 INK4a) (p16 INK4) (p16INK4A)

Length: 156 Mass: 16,533

Tissue specificity: Widely expressed but not detected in brain or skeletal muscle. Isoform 3 is pancreas-specific. {ECO

Sequence

MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADP
ATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEG
PSDIPD

Structural information

Interpro:	IPR020683
Prosite:	PS50297
PDB:	1A5E 1BI7 1DC2 2A5E
PDBsum:	1A5E 1BI7 1DC2 2A5E
DIP:	6108
MINT:	1201444
STRING:	ENSP00000394932;

Other Databases

GeneCards: CDKN2A; Malacards: CDKN2A

Protein general information

Q8N726

Name: Tumor suppressor ARF (Alternative reading frame) (ARF) (Cyclin dependent kinase inhibitor 2A) (p14ARF)

Length: 132 Mass: 13,903

Sequence

MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPSGG
AAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPG

Structural information

Interpro:	IPR010868
Pfam:	PF07392
DIP:	24171
MINT:	2502129

Other Databases

GeneCards: CDKN2A; Malacards: CDKN2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0001953	negative regulation of ce ll-matrix adhesion	IMP	biological_process
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007265	Ras protein signal transd uction	IEP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	ISS	biological_process
GO:0035985	senescence-associated het erochromatin focus	IDA	cellular_component
GO:0035986	senescence-associated het erochromatin focus assemb ly	IMP	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0051059	NF-kappaB binding	IDA	molecular_function
GO:0090398	cellular senescence	IMP	biological_process
GO:0090399	replicative senescence	IMP	biological_process
GO:2000111	positive regulation of ma crophage apoptotic proces s	ISS	biological_process
GO:2000774	positive regulation of ce llular senescence	IMP	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0001953	negative regulation of ce ll-matrix adhesion	IMP	biological_process
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0007049	cell cycle	IEA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007265	Ras protein signal transd uction	IEP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	ISS	biological_process
GO:0035985	senescence-associated het erochromatin focus	IDA	cellular_component
GO:0035986	senescence-associated het erochromatin focus assemb ly	IMP	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0051059	NF-kappaB binding	IDA	molecular_function
GO:0090398	cellular senescence	IMP	biological_process
GO:0090399	replicative senescence	IMP	biological_process
GO:2000111	positive regulation of ma crophage apoptotic proces s	ISS	biological_process
GO:2000774	positive regulation of ce llular senescence	IMP	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0001953	negative regulation of ce ll-matrix adhesion	IMP	biological_process
GO:0004861	cyclin-dependent protein serine/threonine kinase i nhibitor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0007265	Ras protein signal transd uction	IEP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0008285	negative regulation of ce ll proliferation	IMP	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0032088	negative regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	ISS	biological_process
GO:0035985	senescence-associated het erochromatin focus	IDA	cellular_component
GO:0035986	senescence-associated het erochromatin focus assemb ly	IMP	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0042326	negative regulation of ph osphorylation	IDA	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045736	negative regulation of cy clin-dependent protein se rine/threonine kinase act ivity	IDA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0051059	NF-kappaB binding	IDA	molecular_function
GO:0090398	cellular senescence	IMP	biological_process
GO:0090399	replicative senescence	IMP	biological_process
GO:2000111	positive regulation of ma crophage apoptotic proces s	ISS	biological_process
GO:2000774	positive regulation of ce llular senescence	IMP	biological_process
GO:0000209	protein polyubiquitinatio n	IDA	biological_process
GO:0000422	mitophagy	IMP	biological_process
GO:0002039	p53 binding	IPI	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IMP	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006364	rRNA processing	IEA	biological_process
GO:0006469	negative regulation of pr otein kinase activity	IMP	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IMP	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008637	apoptotic mitochondrial c hanges	IMP	biological_process
GO:0010389	regulation of G2/M transi tion of mitotic cell cycl e	IMP	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019789	SUMO transferase activity	EXP	molecular_function
GO:0030889	negative regulation of B cell proliferation	ISS	biological_process
GO:0031647	regulation of protein sta bility	ISS	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0033088	negative regulation of im mature T cell proliferati on in thymus	ISS	biological_process
GO:0033235	positive regulation of pr otein sumoylation	IMP	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043517	positive regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046825	regulation of protein exp ort from nucleus	IMP	biological_process
GO:0048103	somatic stem cell divisio n	ISS	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0051444	negative regulation of ub iquitin-protein transfera se activity	ISS	biological_process
GO:0051882	mitochondrial depolarizat ion	IMP	biological_process
GO:0055105	ubiquitin-protein transfe rase inhibitor activity	ISS	molecular_function
GO:0070534	protein K63-linked ubiqui tination	IDA	biological_process
GO:0071158	positive regulation of ce ll cycle arrest	IDA	biological_process
GO:0090398	cellular senescence	IMP	biological_process
GO:0097371	MDM2/MDM4 family protein binding	IPI	molecular_function
GO:0097371	MDM2/MDM4 family protein binding	IPI	molecular_function
GO:1900182	positive regulation of pr otein localization to nuc leus	IDA	biological_process
GO:1901798	positive regulation of si gnal transduction by p53 class mediator	IDA	biological_process
GO:1902510	regulation of apoptotic D NA fragmentation	IMP	biological_process
GO:1903051	negative regulation of pr oteolysis involved in cel lular protein catabolic p rocess	IMP	biological_process
GO:1903214	regulation of protein tar geting to mitochondrion	IMP	biological_process
GO:2000059	negative regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IDA	biological_process
GO:0016604	nuclear body	IDA	cellular_component
GO:0000209	protein polyubiquitinatio n	IDA	biological_process
GO:0000422	mitophagy	IMP	biological_process
GO:0002039	p53 binding	IPI	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IEA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IMP	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006364	rRNA processing	IEA	biological_process
GO:0006469	negative regulation of pr otein kinase activity	IMP	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IMP	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007050	cell cycle arrest	IEA	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008637	apoptotic mitochondrial c hanges	IMP	biological_process
GO:0010389	regulation of G2/M transi tion of mitotic cell cycl e	IMP	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019789	SUMO transferase activity	EXP	molecular_function
GO:0030889	negative regulation of B cell proliferation	ISS	biological_process
GO:0031647	regulation of protein sta bility	ISS	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0033088	negative regulation of im mature T cell proliferati on in thymus	ISS	biological_process
GO:0033235	positive regulation of pr otein sumoylation	IMP	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043517	positive regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046825	regulation of protein exp ort from nucleus	IMP	biological_process
GO:0048103	somatic stem cell divisio n	ISS	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0051444	negative regulation of ub iquitin-protein transfera se activity	ISS	biological_process
GO:0051882	mitochondrial depolarizat ion	IMP	biological_process
GO:0055105	ubiquitin-protein transfe rase inhibitor activity	ISS	molecular_function
GO:0070534	protein K63-linked ubiqui tination	IDA	biological_process
GO:0071158	positive regulation of ce ll cycle arrest	IDA	biological_process
GO:0090398	cellular senescence	IMP	biological_process
GO:0097371	MDM2/MDM4 family protein binding	IPI	molecular_function
GO:0097371	MDM2/MDM4 family protein binding	IPI	molecular_function
GO:1900182	positive regulation of pr otein localization to nuc leus	IDA	biological_process
GO:1901798	positive regulation of si gnal transduction by p53 class mediator	IDA	biological_process
GO:1902510	regulation of apoptotic D NA fragmentation	IMP	biological_process
GO:1903051	negative regulation of pr oteolysis involved in cel lular protein catabolic p rocess	IMP	biological_process
GO:1903214	regulation of protein tar geting to mitochondrion	IMP	biological_process
GO:2000059	negative regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IDA	biological_process
GO:0016604	nuclear body	IDA	cellular_component
GO:0000209	protein polyubiquitinatio n	IDA	biological_process
GO:0000422	mitophagy	IMP	biological_process
GO:0002039	p53 binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005739	mitochondrion	IMP	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IMP	biological_process
GO:0006919	activation of cysteine-ty pe endopeptidase activity involved in apoptotic pr ocess	IMP	biological_process
GO:0007050	cell cycle arrest	IMP	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008637	apoptotic mitochondrial c hanges	IMP	biological_process
GO:0010389	regulation of G2/M transi tion of mitotic cell cycl e	IMP	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0016925	protein sumoylation	TAS	biological_process
GO:0019789	SUMO transferase activity	EXP	molecular_function
GO:0030889	negative regulation of B cell proliferation	ISS	biological_process
GO:0031647	regulation of protein sta bility	ISS	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0031648	protein destabilization	IDA	biological_process
GO:0033088	negative regulation of im mature T cell proliferati on in thymus	ISS	biological_process
GO:0033235	positive regulation of pr otein sumoylation	IMP	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043517	positive regulation of DN A damage response, signal transduction by p53 clas s mediator	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046825	regulation of protein exp ort from nucleus	IMP	biological_process
GO:0048103	somatic stem cell divisio n	ISS	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0051444	negative regulation of ub iquitin-protein transfera se activity	ISS	biological_process
GO:0051882	mitochondrial depolarizat ion	IMP	biological_process
GO:0055105	ubiquitin-protein transfe rase inhibitor activity	ISS	molecular_function
GO:0070534	protein K63-linked ubiqui tination	IDA	biological_process
GO:0071158	positive regulation of ce ll cycle arrest	IDA	biological_process
GO:0090398	cellular senescence	IMP	biological_process
GO:0097371	MDM2/MDM4 family protein binding	IPI	molecular_function
GO:0097371	MDM2/MDM4 family protein binding	IPI	molecular_function
GO:1900182	positive regulation of pr otein localization to nuc leus	IDA	biological_process
GO:1901798	positive regulation of si gnal transduction by p53 class mediator	IDA	biological_process
GO:1902510	regulation of apoptotic D NA fragmentation	IMP	biological_process
GO:1903051	negative regulation of pr oteolysis involved in cel lular protein catabolic p rocess	IMP	biological_process
GO:1903214	regulation of protein tar geting to mitochondrion	IMP	biological_process
GO:2000059	negative regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IDA	biological_process
GO:0016604	nuclear body	IDA	cellular_component

KEGG pathways

hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05166  HTLV-I infection
hsa05203  Viral carcinogenesis
hsa01522  Endocrine resistance
hsa04110  Cell cycle
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05212  Pancreatic cancer
hsa01524  Platinum drug resistance
hsa05219  Bladder cancer
hsa04115  p53 signaling pathway
hsa05214  Glioma
hsa05223  Non-small cell lung cancer

Diseases

Associated diseases	References
Adenomyosis	PMID: 11078826
Adult T-cell leukemia	KEGG: H00009
Alzheimer's disease	PMID: 18761660
Atherosclerosis	PMID: 17351341
Bladder cancer	KEGG: H00022
Burkitt lymphoma	KEGG: H00008
Cancer	PMID: 8603820
Cholangiocarcinoma	KEGG: H00046
Chronic myeloid leukemia	KEGG: H00004
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Defective human spermatozoa	PMID: 26804237
Diabetes	PMID: 17463248, KEGG: H00409
Endometriosis	PMID: 11163832
Endometriotic and adenomyotic tissues	PMID: 16616093
Esophageal cancer	KEGG: H00017
Gallbladder cancer	KEGG: H00047
Glioma	KEGG: H00042
Hepatocellular carcinoma	KEGG: H00048
Laryngeal cancer	KEGG: H00055
Malignant melanoma	KEGG: H00038
Malignant pleural mesothelioma	KEGG: H00015
Mantle cell lymphoma	KEGG: H01464
Meningioma	KEGG: H01556
Mycosis fungoides	KEGG: H01463
Nasopharyngeal cancer	KEGG: H00054
Non-small cell lung cancer	KEGG: H00014
Oral cancer	KEGG: H00016
Osteosarcoma	KEGG: H00036
Pancreatic cancer	KEGG: H00019
Penile cancer	KEGG: H00025
Retinoblastoma	KEGG: H01513
Salivary gland cancer	KEGG: H01508
Adenomyosis	INFBASE16616093
Endometriosis	INFBASE11163832
Squamous cell carcinoma	KEGG: H00040
Tonsillar cancer	KEGG: H01509

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16616093	Endometrio sis			56 (25 women wi th endometrioma s, 31 women wit h adenomyosis)		p16 pRb cyclin D1	Show abstract
11163832	Endometrio sis					p16(Ink4) GALT p53 APOA2	Show abstract