Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 10406
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol WFDC2   Gene   UCSC   Ensembl
Aliases EDDM4, HE4, WAP5, dJ461P17.6
Gene name WAP four-disulfide core domain 2
Alternate names WAP four-disulfide core domain protein 2, WAP domain containing protein HE4-V4, epididymal protein 4, epididymal secretory protein E4, epididymis-specific, whey-acidic protein type, four-disulfide core, major epididymis-specific protein E4, putative protease in,
Gene location 20q13.12 (45469753: 45481531)     Exons: 4     NC_000020.11
Gene summary(Entrez) This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq, Jul 2008]

Protein Summary

Protein general information Q14508  

Name: WAP four disulfide core domain protein 2 (Epididymal secretory protein E4) (Major epididymis specific protein E4) (Putative protease inhibitor WAP5)

Length: 124  Mass: 12,993

Tissue specificity: Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines.

Sequence MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPND
KEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Structural information
Protein Domains
WAP (31-73)
WAP (74-123)
Interpro:  IPR008197
Prosite:   PS51390

Pfam:  
PF00095
MINT:   1429295
STRING:   ENSP00000361761;
Other Databases GeneCards:  WFDC2;  Malacards:  WFDC2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0004866 endopeptidase inhibitor a
ctivity
TAS molecular_function
GO:0004867 serine-type endopeptidase
inhibitor activity
IDA molecular_function
GO:0004869 cysteine-type endopeptida
se inhibitor activity
IEA molecular_function
GO:0005615 extracellular space
TAS cellular_component
GO:0006508 proteolysis
TAS biological_process
GO:0007283 spermatogenesis
TAS biological_process
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological_process
GO:0019828 aspartic-type endopeptida
se inhibitor activity
IDA molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0004866 endopeptidase inhibitor a
ctivity
TAS molecular_function
GO:0004867 serine-type endopeptidase
inhibitor activity
IEA molecular_function
GO:0004867 serine-type endopeptidase
inhibitor activity
IDA molecular_function
GO:0004869 cysteine-type endopeptida
se inhibitor activity
IEA molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0006508 proteolysis
TAS biological_process
GO:0007283 spermatogenesis
TAS biological_process
GO:0010466 negative regulation of pe
ptidase activity
IEA biological_process
GO:0010951 negative regulation of en
dopeptidase activity
IEA biological_process
GO:0019828 aspartic-type endopeptida
se inhibitor activity
IEA molecular_function
GO:0019828 aspartic-type endopeptida
se inhibitor activity
IDA molecular_function
GO:0030414 peptidase inhibitor activ
ity
IEA molecular_function
GO:0030414 peptidase inhibitor activ
ity
IEA molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0004866 endopeptidase inhibitor a
ctivity
TAS molecular_function
GO:0004867 serine-type endopeptidase
inhibitor activity
IDA molecular_function
GO:0005615 extracellular space
TAS cellular_component
GO:0006508 proteolysis
TAS biological_process
GO:0007283 spermatogenesis
TAS biological_process
GO:0019828 aspartic-type endopeptida
se inhibitor activity
IDA molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component

Diseases

Associated diseases References
Endometriosis PMID: 26512790
Adnexal malignancy INFBASE26512790
Endometriosis INFBASE26512790

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
26512790 Endometrio
sis
Europea
n cente
rs (Ita
ly, Por
tugal,
Latvia,
and Sp
ain)
1046 (981 healt
hy patients dia
gnosed with adn
exal patology a
nd selected 65
patients diagno
sed with endome
triosis)

Show abstract