Endometriosis Knowledgebase

Search Result

Gene id

10413

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

YAP1 Gene UCSC Ensembl

Aliases

COB1, YAP, YAP2, YAP65, YKI

Gene name

Yes associated protein 1

Alternate names

transcriptional coactivator YAP1, 65 kDa Yes-associated protein, protein yorkie homolog, yes-associated protein 1, yes-associated protein 2, yes-associated protein YAP65 homolog, yorkie homolog,

Gene location

11q22.1 (102109956: 102233422) Exons: 10 NC_000011.10

Gene summary(Entrez)

This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2013]

OMIM

606608

Protein Summary

Protein general information

P46937

Name: Transcriptional coactivator YAP1 (Yes associated protein 1) (Protein yorkie homolog) (Yes associated protein YAP65 homolog)

Length: 504 Mass: 54,462

Tissue specificity: Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level). {ECO

Sequence

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNP
KTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSG
PAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMM
NSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS
NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELR
TMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPG
TNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Structural information

Protein Domains	WW (171-204) WW (230-263)
Interpro:	IPR001202
Prosite:	PS01159 PS50020
Pfam:	PF00397
PDB:	1JMQ 1K5R 1K9Q 1K9R 2LAW 2LAX 2LAY 2LTV 2LTW 3KYS 3MHR 4RE1 4REX
PDBsum:	1JMQ 1K5R 1K9Q 1K9R 2LAW 2LAX 2LAY 2LTV 2LTW 3KYS 3MHR 4RE1 4REX
DIP:	40839
MINT:	110802
STRING:	ENSP00000282441;

Other Databases

GeneCards: YAP1; Malacards: YAP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000902	cell morphogenesis	IEA	biological_process
GO:0000979	RNA polymerase II core pr omoter sequence-specific DNA binding	IEA	molecular_function
GO:0001076	transcription factor acti vity, RNA polymerase II t ranscription factor bindi ng	IEA	molecular_function
GO:0001570	vasculogenesis	IEA	biological_process
GO:0003143	embryonic heart tube morp hogenesis	IEA	biological_process
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0008022	protein C-terminus bindin g	IEA	molecular_function
GO:0008283	cell proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0010837	regulation of keratinocyt e proliferation	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0030216	keratinocyte differentiat ion	IEA	biological_process
GO:0030857	negative regulation of ep ithelial cell differentia tion	IEA	biological_process
GO:0030903	notochord development	IEA	biological_process
GO:0035019	somatic stem cell populat ion maintenance	IEA	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046622	positive regulation of or gan growth	IEA	biological_process
GO:0048339	paraxial mesoderm develop ment	IEA	biological_process
GO:0048368	lateral mesoderm developm ent	IEA	biological_process
GO:0050767	regulation of neurogenesi s	IDA	biological_process
GO:0060242	contact inhibition	IDA	biological_process
GO:0060449	bud elongation involved i n lung branching	IEA	biological_process
GO:0060487	lung epithelial cell diff erentiation	IEA	biological_process
GO:0070064	proline-rich region bindi ng	IEA	molecular_function
GO:0071300	cellular response to reti noic acid	IEA	biological_process
GO:0071480	cellular response to gamm a radiation	IDA	biological_process
GO:0072091	regulation of stem cell p roliferation	IDA	biological_process
GO:0072307	regulation of metanephric nephron tubule epithelia l cell differentiation	IEA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:1902459	positive regulation of st em cell population mainte nance	IEA	biological_process
GO:1903507	negative regulation of nu cleic acid-templated tran scription	IEA	biological_process
GO:2000737	negative regulation of st em cell differentiation	IEA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IEA	biological_process
GO:0000902	cell morphogenesis	IEA	biological_process
GO:0000979	RNA polymerase II core pr omoter sequence-specific DNA binding	IEA	molecular_function
GO:0001076	transcription factor acti vity, RNA polymerase II t ranscription factor bindi ng	IEA	molecular_function
GO:0001570	vasculogenesis	IEA	biological_process
GO:0003143	embryonic heart tube morp hogenesis	IEA	biological_process
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003713	transcription coactivator activity	IEA	molecular_function
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0008022	protein C-terminus bindin g	IEA	molecular_function
GO:0008283	cell proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0010837	regulation of keratinocyt e proliferation	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0030216	keratinocyte differentiat ion	IEA	biological_process
GO:0030857	negative regulation of ep ithelial cell differentia tion	IEA	biological_process
GO:0030903	notochord development	IEA	biological_process
GO:0035019	somatic stem cell populat ion maintenance	IEA	biological_process
GO:0035329	hippo signaling	IEA	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046622	positive regulation of or gan growth	IEA	biological_process
GO:0048339	paraxial mesoderm develop ment	IEA	biological_process
GO:0048368	lateral mesoderm developm ent	IEA	biological_process
GO:0050767	regulation of neurogenesi s	IDA	biological_process
GO:0060242	contact inhibition	IDA	biological_process
GO:0060449	bud elongation involved i n lung branching	IEA	biological_process
GO:0060487	lung epithelial cell diff erentiation	IEA	biological_process
GO:0060828	regulation of canonical W nt signaling pathway	IEA	biological_process
GO:0070064	proline-rich region bindi ng	IEA	molecular_function
GO:0071300	cellular response to reti noic acid	IEA	biological_process
GO:0071480	cellular response to gamm a radiation	IDA	biological_process
GO:0072091	regulation of stem cell p roliferation	IEA	biological_process
GO:0072091	regulation of stem cell p roliferation	IDA	biological_process
GO:0072307	regulation of metanephric nephron tubule epithelia l cell differentiation	IEA	biological_process
GO:0090263	positive regulation of ca nonical Wnt signaling pat hway	IEA	biological_process
GO:1902459	positive regulation of st em cell population mainte nance	IEA	biological_process
GO:1903507	negative regulation of nu cleic acid-templated tran scription	IEA	biological_process
GO:2000737	negative regulation of st em cell differentiation	IEA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IEA	biological_process
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0003713	transcription coactivator activity	IDA	molecular_function
GO:0003714	transcription corepressor activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0008283	cell proliferation	IDA	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0035329	hippo signaling	TAS	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0050767	regulation of neurogenesi s	IDA	biological_process
GO:0060242	contact inhibition	IDA	biological_process
GO:0071480	cellular response to gamm a radiation	IDA	biological_process
GO:0072091	regulation of stem cell p roliferation	IDA	biological_process

KEGG pathways

hsa04390 Hippo signaling pathway
hsa04392 Hippo signaling pathway -multiple species

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 21116278
Coloboma	OMIM: 606608
Endometriosis	PMID: 28608501
Hyperandrogenism	PMID: 28961951
Endometriosis	INFBASE28608501
Polycystic ovary syndrome (PCOS)	PMID: 24106282

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28608501	Endometrio sis					LATS1	Show abstract