Endometriosis Knowledgebase

Search Result

Gene id

10424

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PGRMC2 Gene UCSC Ensembl

Aliases

DG6, PMBP

Gene name

progesterone receptor membrane component 2

Alternate names

membrane-associated progesterone receptor component 2, progesterone membrane binding protein, steroid receptor protein DG6,

Gene location

4q28.2 (128288828: 128269236) Exons: 4 NC_000004.12

OMIM

607735

Protein Summary

Protein general information

O15173

Name: Membrane associated progesterone receptor component 2 (Progesterone membrane binding protein) (Steroid receptor protein DG6)

Length: 223 Mass: 23,818

Sequence

MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVALVALVLLGAYRLWVRW
GRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRD
ASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD

Structural information

Protein Domains	Cytochrome (102-201)
Interpro:	IPR001199
Pfam:	PF00173
MINT:	5002204
STRING:	ENSP00000429301;

Other Databases

GeneCards: PGRMC2; Malacards: PGRMC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003707	steroid hormone receptor activity	TAS	molecular_function
GO:0005496	steroid binding	IEA	molecular_function
GO:0012505	endomembrane system	IBA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0020037	heme binding	IBA	molecular_function
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological_process
GO:0003707	steroid hormone receptor activity	TAS	molecular_function
GO:0005496	steroid binding	IEA	molecular_function
GO:0005496	steroid binding	TAS	molecular_function
GO:0008289	lipid binding	IEA	molecular_function
GO:0012505	endomembrane system	IBA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	TAS	cellular_component
GO:0020037	heme binding	IBA	molecular_function
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological_process
GO:0003707	steroid hormone receptor activity	TAS	molecular_function
GO:0005496	steroid binding	TAS	molecular_function
GO:0012505	endomembrane system	IBA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	TAS	cellular_component
GO:0020037	heme binding	IBA	molecular_function

Diseases

Associated diseases	References
Diminished ovarian reserve (DOR)	PMID: 22355044
Endometriosis	PMID: 23793472
Endometriosis	INFBASE23793472

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23793472	Endometrio sis			34 (11 women wi th laparoscopic ally and/or his tologically pro ven stage III/I V endometriosis , 23 disease-fr ee women)		PGRMC-1 PGRMC-2	Show abstract