Endometriosis Knowledgebase

Search Result

Gene id

10439

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

OLFM1 Gene UCSC Ensembl

Aliases

AMY, NOE1, NOELIN1, OlfA

Gene name

olfactomedin 1

Alternate names

noelin, neuroblastoma protein, neuronal olfactomedin-related ER localized protein, olfactomedin related ER localized protein, pancortin 1,

Gene location

9q34.3 (135075242: 135121183) Exons: 9 NC_000009.12

Gene summary(Entrez)

This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

605366

Protein Summary

Protein general information

Q99784

Name: Noelin (Neuronal olfactomedin related ER localized protein) (Olfactomedin 1)

Length: 485 Mass: 55,343

Sequence

MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLSAAGGGTLDRSTGVLPTNPEESWQVYSSAQDSEGRCIC
TVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLARQ
FKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSVLNELQEEIGAYDYDELQSRVSNLEERLRACMQKL
ACGKLTGISDPVTVKTSGSRFGSWMTDPLAPEGDNRVWYMDGYHNNRFVREYKSMVDFMNTDNFTSHRLPHPWSG
TGQVVYNGSIYFNKFQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVDESGLWAVYATNQNAG
NIVVSRLDPVSLQTLQTWNTSYPKRSAGEAFIICGTLYVTNGYSGGTKVHYAYQTNASTYEYIDIPFQNKYSHIS
MLDYNPKDRALYAWNNGHQILYNVTLFHVIRSDEL

Structural information

Protein Domains	Olfactomedin-like. (226-478)
Interpro:	IPR031217 IPR022082 IPR003112 IPR011044 IPR015943
Prosite:	PS00014 PS51132
Pfam:	PF12308 PF02191
PDB:	4XAT
PDBsum:	4XAT
STRING:	ENSP00000252854;

Other Databases

GeneCards: OLFM1; Malacards: OLFM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003190	atrioventricular valve fo rmation	ISS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	ISS	cellular_component
GO:0005623	cell	ISS	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	ISS	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	ISS	biological_process
GO:0023041	neuronal signal transduct ion	ISS	biological_process
GO:0030054	cell junction	IEA	cellular_component
GO:0030424	axon	ISS	cellular_component
GO:0030516	regulation of axon extens ion	ISS	biological_process
GO:0043025	neuronal cell body	ISS	cellular_component
GO:0043204	perikaryon	IEA	cellular_component
GO:0044295	axonal growth cone	ISS	cellular_component
GO:0045202	synapse	IEA	cellular_component
GO:0060317	cardiac epithelial to mes enchymal transition	ISS	biological_process
GO:0003190	atrioventricular valve fo rmation	ISS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005623	cell	ISS	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007399	nervous system developmen t	IEA	biological_process
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	ISS	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	ISS	biological_process
GO:0023041	neuronal signal transduct ion	ISS	biological_process
GO:0030054	cell junction	IEA	cellular_component
GO:0030424	axon	ISS	cellular_component
GO:0030424	axon	IEA	cellular_component
GO:0030516	regulation of axon extens ion	ISS	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043025	neuronal cell body	ISS	cellular_component
GO:0043204	perikaryon	IEA	cellular_component
GO:0044295	axonal growth cone	ISS	cellular_component
GO:0045202	synapse	IEA	cellular_component
GO:0045202	synapse	IEA	cellular_component
GO:0060317	cardiac epithelial to mes enchymal transition	ISS	biological_process
GO:0003190	atrioventricular valve fo rmation	ISS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	ISS	cellular_component
GO:0005623	cell	ISS	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0007399	nervous system developmen t	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	ISS	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	ISS	biological_process
GO:0023041	neuronal signal transduct ion	ISS	biological_process
GO:0030424	axon	ISS	cellular_component
GO:0030516	regulation of axon extens ion	ISS	biological_process
GO:0043025	neuronal cell body	ISS	cellular_component
GO:0044295	axonal growth cone	ISS	cellular_component
GO:0060317	cardiac epithelial to mes enchymal transition	ISS	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 12810542
Female infertility	INFBASE12810542
Implantation defects	INFBASE12810542
Endometriosis	INFBASE12810542
Implantation failure	PMID: 12810542

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12810542	Endometrio sis					IL-15 proline-rich protein B61 Dickkopf-1 glycodelin N-acetylglucosamine-6-O-sulfotransferase G0S2 protein purine nucleoside phosphorylase semaphorin E neuronal olfactomedin-related endoplasmic reticulum localized protein mRNA Sam68-like phospho	Show abstract