Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 1044
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CDX1   Gene   UCSC   Ensembl
Gene name caudal type homeobox 1
Alternate names homeobox protein CDX-1, caudal type homeo box transcription factor 1, caudal type homeobox transcription factor 1, caudal-type homeobox protein 1, caudal-type homeobox protein CDX1,
Gene location 5q32 (150166780: 150184557)     Exons: 3     NC_000005.10
Gene summary(Entrez) This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity. [provided by RefSeq, Jul 2008]
OMIM 600746

Protein Summary

Protein general information P47902  

Name: Homeobox protein CDX 1 (Caudal type homeobox protein 1)

Length: 265  Mass: 28,138

Tissue specificity: Intestinal epithelium.

Sequence MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAA
YGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSVAAGGGGGSGK
TRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKKKQQQQQPPQP
PMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP
Structural information
Interpro:  IPR006820 IPR009057 IPR017970 IPR001356 IPR020479 IPR000047
Prosite:   PS00027 PS50071

Pfam:  
PF04731 PF00046
MINT:   6800278
STRING:   ENSP00000231656;
Other Databases GeneCards:  CDX1;  Malacards:  CDX1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000980 RNA polymerase II distal
enhancer sequence-specifi
c DNA binding
IDA molecular_function
GO:0001205 transcriptional activator
activity, RNA polymerase
II distal enhancer seque
nce-specific binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IBA cellular_component
GO:0006366 transcription from RNA po
lymerase II promoter
IEA biological_process
GO:0009887 animal organ morphogenesi
s
TAS biological_process
GO:0009948 anterior/posterior axis s
pecification
IBA biological_process
GO:0014807 regulation of somitogenes
is
ISS biological_process
GO:0030154 cell differentiation
IBA biological_process
GO:0044212 transcription regulatory
region DNA binding
IDA molecular_function
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IMP biological_process
GO:0060349 bone morphogenesis
IEA biological_process
GO:0000980 RNA polymerase II distal
enhancer sequence-specifi
c DNA binding
IDA molecular_function
GO:0001205 transcriptional activator
activity, RNA polymerase
II distal enhancer seque
nce-specific binding
IDA molecular_function
GO:0003677 DNA binding
IEA molecular_function
GO:0003677 DNA binding
IEA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IBA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0006351 transcription, DNA-templa
ted
IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological_process
GO:0006366 transcription from RNA po
lymerase II promoter
IEA biological_process
GO:0007275 multicellular organism de
velopment
IEA biological_process
GO:0007275 multicellular organism de
velopment
IEA biological_process
GO:0007389 pattern specification pro
cess
IEA biological_process
GO:0009887 animal organ morphogenesi
s
TAS biological_process
GO:0009948 anterior/posterior axis s
pecification
IBA biological_process
GO:0009952 anterior/posterior patter
n specification
IEA biological_process
GO:0014807 regulation of somitogenes
is
IEA biological_process
GO:0014807 regulation of somitogenes
is
ISS biological_process
GO:0030154 cell differentiation
IBA biological_process
GO:0043565 sequence-specific DNA bin
ding
IEA molecular_function
GO:0044212 transcription regulatory
region DNA binding
IDA molecular_function
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IEA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IMP biological_process
GO:0060349 bone morphogenesis
IEA biological_process
GO:0000980 RNA polymerase II distal
enhancer sequence-specifi
c DNA binding
IDA molecular_function
GO:0001205 transcriptional activator
activity, RNA polymerase
II distal enhancer seque
nce-specific binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IBA cellular_component
GO:0009887 animal organ morphogenesi
s
TAS biological_process
GO:0009948 anterior/posterior axis s
pecification
IBA biological_process
GO:0014807 regulation of somitogenes
is
ISS biological_process
GO:0030154 cell differentiation
IBA biological_process
GO:0044212 transcription regulatory
region DNA binding
IDA molecular_function
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IMP biological_process

Diseases

Associated diseases References
Cancer PMID: 12970739
Endometriosis PMID: 21613300
Endometriosis INFBASE21613300

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21613300 Endometrio
sis

20 (10 women wi
th endometriosi
s, 10 control w
omen)
COX-2
CDX1
SHP
HIF-1
Show abstract