Endometriosis Knowledgebase

Search Result

Gene id

10562

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

OLFM4 Gene UCSC Ensembl

Aliases

GC1, GW112, OLM4, OlfD, UNQ362, bA209J19.1, hGC-1, hOLfD

Gene name

olfactomedin 4

Alternate names

olfactomedin-4, G-CSF-stimulated clone 1 protein, antiapoptotic protein GW112,

Gene location

13q14.3 (53028740: 53052060) Exons: 5 NC_000013.11

Gene summary(Entrez)

This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. This gene encodes a member of the olfactomedin family. The encoded protein is an antiapoptotic factor that promotes tumor growth and is an extracellular matrix glycoprotein that facilitates cell adhesion. [provided by RefSeq, Mar 2011]

OMIM

614061

Protein Summary

Protein general information

Q6UX06

Name: Olfactomedin 4 (OLM4) (Antiapoptotic protein GW112) (G CSF stimulated clone 1 protein) (hGC 1) (hOLfD)

Length: 510 Mass: 57,280

Tissue specificity: Expressed during myeloid lineage development. Much higher expression in bone marrow neutrophils than in peripheral blood neutrophils (at protein level). Strongly expressed in the prostate, small intestine and colon and moderately expre

Sequence

MRPGLSFLLALLFFLGQAAGDLGDVGPPIPSPGFSSFPGVDSSSSFSSSSRSGSSSSRSLGSGGSVSQLFSNFTG
SVDDRGTCQCSVSLPDTTFPVDRVERLEFTAHVLSQKFEKELSKVREYVQLISVYEKKLLNLTVRIDIMEKDTIS
YTELDFELIKVEVKEMEKLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKE
CEASKDQNTPVVHPPPTPGSCGHGGVVNISKPSVVQLNWRGFSYLYGAWGRDYSPQHPNKGLYWVAPLNTDGRLL
EYYRLYNTLDDLLLYINARELRITYGQGSGTAVYNNNMYVNMYNTGNIARVNLTTNTIAVTQTLPNAAYNNRFSY
ANVAWQDIDFAVDENGLWVIYSTEASTGNMVISKLNDTTLQVLNTWYTKQYKPSASNAFMVCGVLYATRTMNTRT
EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLNYDLSVLQKPQ

Structural information

Protein Domains	Olfactomedin-like. (245-507)
Interpro:	IPR003112 IPR031221 IPR011041 IPR015943
Prosite:	PS51132
Pfam:	PF02191
DIP:	59533
STRING:	ENSP00000219022;

Other Databases

GeneCards: OLFM4; Malacards: OLFM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003824	catalytic activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IMP	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0042581	specific granule	IDA	cellular_component
GO:0042803	protein homodimerization activity	IMP	molecular_function
GO:0045296	cadherin binding	IMP	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0051260	protein homooligomerizati on	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1900026	positive regulation of su bstrate adhesion-dependen t cell spreading	IDA	biological_process
GO:0010939	regulation of necrotic ce ll death	IMP	biological_process
GO:0030141	secretory granule	IDA	cellular_component
GO:0042582	azurophil granule	IDA	cellular_component
GO:0042981	regulation of apoptotic p rocess	IMP	biological_process
GO:0050764	regulation of phagocytosi s	IMP	biological_process
GO:2000389	regulation of neutrophil extravasation	IMP	biological_process
GO:0003824	catalytic activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IMP	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0042581	specific granule	IDA	cellular_component
GO:0042803	protein homodimerization activity	IMP	molecular_function
GO:0045296	cadherin binding	IMP	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0051260	protein homooligomerizati on	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1900026	positive regulation of su bstrate adhesion-dependen t cell spreading	IDA	biological_process
GO:0010939	regulation of necrotic ce ll death	IMP	biological_process
GO:0030141	secretory granule	IDA	cellular_component
GO:0042582	azurophil granule	IDA	cellular_component
GO:0042981	regulation of apoptotic p rocess	IMP	biological_process
GO:0050764	regulation of phagocytosi s	IMP	biological_process
GO:2000389	regulation of neutrophil extravasation	IMP	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IMP	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0042581	specific granule	IDA	cellular_component
GO:0042803	protein homodimerization activity	IMP	molecular_function
GO:0045296	cadherin binding	IMP	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0051260	protein homooligomerizati on	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1900026	positive regulation of su bstrate adhesion-dependen t cell spreading	IDA	biological_process
GO:0010939	regulation of necrotic ce ll death	IMP	biological_process
GO:0030141	secretory granule	IDA	cellular_component
GO:0042582	azurophil granule	IDA	cellular_component
GO:0042981	regulation of apoptotic p rocess	IMP	biological_process
GO:0050764	regulation of phagocytosi s	IMP	biological_process
GO:2000389	regulation of neutrophil extravasation	IMP	biological_process

Diseases

Associated diseases	References
Amyotrophic lateral sclerosis (ALS)	PMID: 17362836
Embryo development	PMID: 23605819
Endometriosis	PMID: 21048224
Heart disease	PMID: 17903304
Insulin resistance	PMID: 17903298
Obesity	PMID: 22484627
Endometriosis	INFBASE21048224
Fertilizing defects	PMID: 24999734
Stroke	PMID: 17434096

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21048224	Endometrio sis						Show abstract