Endometriosis Knowledgebase

Search Result

Gene id

10631

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

POSTN Gene UCSC Ensembl

Aliases

OSF-2, OSF2, PDLPOSTN, PN

Gene name

periostin

Alternate names

periostin, osteoblast specific factor 2 (fasciclin I-like), periodontal ligament-specific periostin, periostin, osteoblast specific factor,

Gene location

13q13.3 (37598843: 37562581) Exons: 25 NC_000013.11

Gene summary(Entrez)

This gene encodes a secreted extracellular matrix protein that functions in tissue development and regeneration, including wound healing, and ventricular remodeling following myocardial infarction. The encoded protein binds to integrins to support adhesion and migration of epithelial cells. This protein plays a role in cancer stem cell maintenance and metastasis. Mice lacking this gene exhibit cardiac valve disease, and skeletal and dental defects. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]

OMIM

608777

Protein Summary

Protein general information

Q15063

Name: Periostin (PN) (Osteoblast specific factor 2) (OSF 2)

Length: 836 Mass: 93,314

Tissue specificity: Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus, thyroid tissue and breast. Up-regulated in epithelial ovarian tumors. Not expressed in normal ovaries. Also highly expressed at the

Sequence

MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTV
LYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIR
RGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHV
IDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
MKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPDSAKQVIE
LAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMDQRLLKLILQNHILKVKVGLNELYNGQILE
TIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELL
TQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVND
TLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVYTTKIIT
KVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETITEVIHGEPIIKKYTKIIDGVPVEITEKETR
EERIITGPEIKYTRISTGGGETEETLKKLLQEEVTKVTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQG
SRRRLREGRSQ

Structural information

Protein Domains	EMI. (40-94) FAS1 (97-230) FAS1 (234-365) FAS1 (368-492)
Interpro:	IPR011489 IPR000782 IPR016666
Prosite:	PS51041 PS50213
Pfam:	PF02469
MINT:	4533078
STRING:	ENSP00000369071;

Other Databases

GeneCards: POSTN; Malacards: POSTN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001501	skeletal system developme nt	TAS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001953	negative regulation of ce ll-matrix adhesion	IEA	biological_process
GO:0003073	regulation of systemic ar terial blood pressure	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005578	proteinaceous extracellul ar matrix	ISS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IBA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005802	trans-Golgi network	IDA	cellular_component
GO:0007155	cell adhesion	IDA	biological_process
GO:0008201	heparin binding	ISS	molecular_function
GO:0008593	regulation of Notch signa ling pathway	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0014850	response to muscle activi ty	IEA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0030198	extracellular matrix orga nization	IBA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031594	neuromuscular junction	IEA	cellular_component
GO:0032355	response to estradiol	IEA	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IEA	biological_process
GO:0046872	metal ion binding	IDA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IBA	molecular_function
GO:0071307	cellular response to vita min K	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:1900025	negative regulation of su bstrate adhesion-dependen t cell spreading	IEA	biological_process
GO:1904209	positive regulation of ch emokine (C-C motif) ligan d 2 secretion	IEA	biological_process
GO:1990138	neuron projection extensi on	IEA	biological_process
GO:1990523	bone regeneration	IEA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0001501	skeletal system developme nt	TAS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001953	negative regulation of ce ll-matrix adhesion	IEA	biological_process
GO:0003073	regulation of systemic ar terial blood pressure	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	ISS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IBA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005802	trans-Golgi network	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0008201	heparin binding	IEA	molecular_function
GO:0008201	heparin binding	ISS	molecular_function
GO:0008201	heparin binding	IEA	molecular_function
GO:0008593	regulation of Notch signa ling pathway	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009888	tissue development	IEA	biological_process
GO:0014850	response to muscle activi ty	IEA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IEA	biological_process
GO:0030198	extracellular matrix orga nization	IEA	biological_process
GO:0030198	extracellular matrix orga nization	IBA	biological_process
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031594	neuromuscular junction	IEA	cellular_component
GO:0032355	response to estradiol	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0044344	cellular response to fibr oblast growth factor stim ulus	IEA	biological_process
GO:0046872	metal ion binding	IDA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IBA	molecular_function
GO:0071307	cellular response to vita min K	IDA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:1900025	negative regulation of su bstrate adhesion-dependen t cell spreading	IEA	biological_process
GO:1904209	positive regulation of ch emokine (C-C motif) ligan d 2 secretion	IEA	biological_process
GO:1990138	neuron projection extensi on	IEA	biological_process
GO:1990523	bone regeneration	IEA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0001501	skeletal system developme nt	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005578	proteinaceous extracellul ar matrix	ISS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IBA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005802	trans-Golgi network	IDA	cellular_component
GO:0007155	cell adhesion	IDA	biological_process
GO:0008201	heparin binding	ISS	molecular_function
GO:0030198	extracellular matrix orga nization	IBA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0046872	metal ion binding	IDA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IBA	molecular_function
GO:0071307	cellular response to vita min K	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Cancer	PMID: 16807673
Endometriosis	PMID: 22471299
Endometriosis	INFBASE27251862

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22471299	Endometrio sis			65 (35 women di agnosed as endo metriosis, 30 h ealthy women)		periostin	Show abstract
27251862	Endometrio sis			184 women with and without end ometriosis			Show abstract