Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 10656
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol KHDRBS3   Gene   UCSC   Ensembl
Aliases Etle, SALP, SLM-2, SLM2, T-STAR, TSTAR, etoile
Gene name KH RNA binding domain containing, signal transduction associated 3
Alternate names KH domain-containing, RNA-binding, signal transduction-associated protein 3, KH domain containing, RNA binding, signal transduction associated 3, RNA-binding protein T-Star, Sam68-like phosphotyrosine protein, T-STAR, sam68-like mammalian protein 2,
Gene location 8q24.23 (135457460: 135656515)     Exons: 16     NC_000008.11
OMIM 610421

Protein Summary

Protein general information O75525  

Name: KH domain containing, RNA binding, signal transduction associated protein 3 (RNA binding protein T Star) (Sam68 like mammalian protein 2) (SLM 2) (Sam68 like phosphotyrosine protein)

Length: 346  Mass: 38,800

Tissue specificity: Ubiquitous with higher expression in testis, skeletal muscle and brain. Expressed in the kidney only in podocytes, the glomerular epithelial cells of the kidney. Strongly expressed after meiosis. {ECO

Sequence MEEKYLPELMAEKDSLDPSFTHALRLVNQEIEKFQKGEGKDEEKYIDVVINKNMKLGQKVLIPVKQFPKFNFVGK
LLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEE
IKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTP
RGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDSYDNSYSTPAQSGAD
YYDYGHGLSEETYDSYGQEEWTNSRHKAPSARTAKGVYRDQPYGRY
Structural information
Protein Domains
KH. (61-127)
Interpro:  IPR004087 IPR004088 IPR032571 IPR032335

Pfam:  
PF00013 PF16274 PF16568

PDB:  
5EL3 5ELR 5ELS 5ELT 5EMO
PDBsum:   5EL3 5ELR 5ELS 5ELT 5EMO
MINT:   1411200
STRING:   ENSP00000348108;
Other Databases GeneCards:  KHDRBS3;  Malacards:  KHDRBS3

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0003723 RNA binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
TAS cellular_component
GO:0005654 nucleoplasm
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0006351 transcription, DNA-templa
ted
IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological_process
GO:0007283 spermatogenesis
TAS biological_process
GO:0017124 SH3 domain binding
IEA molecular_function
GO:0044822 poly(A) RNA binding
IDA molecular_function
GO:0003676 nucleic acid binding
IEA molecular_function
GO:0003723 RNA binding
IEA molecular_function
GO:0003723 RNA binding
IEA molecular_function
GO:0003723 RNA binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
TAS cellular_component
GO:0005654 nucleoplasm
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0006351 transcription, DNA-templa
ted
IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological_process
GO:0007283 spermatogenesis
TAS biological_process
GO:0017124 SH3 domain binding
IEA molecular_function
GO:0044822 poly(A) RNA binding
IDA molecular_function
GO:0003723 RNA binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
TAS cellular_component
GO:0005654 nucleoplasm
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0007283 spermatogenesis
TAS biological_process
GO:0044822 poly(A) RNA binding
IDA molecular_function

Diseases

Associated diseases References
Endometriosis PMID: 12810542
Epilepsy PMID: 12921630
Implantation failure PMID: 12810542
Polycystic ovary syndrome (PCOS) PMID: 25574032
Female infertility INFBASE12810542
Implantation defects INFBASE12810542
Endometriosis INFBASE12810542

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
12810542 Endometrio
sis


IL-15
proline-rich protein
B61
Dickkopf-1
glycodelin
N-acetylglucosamine-6-O-sulfotransferase
G0S2 protein
purine nucleoside phosphorylase
semaphorin E
neuronal olfactomedin-related endoplasmic reticulum localized protein mRNA
Sam68-like phospho
Show abstract