Endometriosis Knowledgebase

Search Result

Gene id

10663

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CXCR6 Gene UCSC Ensembl

Aliases

BONZO, CD186, STRL33, TYMSTR

Gene name

C-X-C motif chemokine receptor 6

Alternate names

C-X-C chemokine receptor type 6, CDw186, CXC-R6, CXCR-6, G protein-coupled receptor, G-protein coupled receptor STRL33, G-protein coupled receptor bonzo, chemokine (C-X-C motif) receptor 6,

Gene location

3p21.31 (45940687: 45948353) Exons: 4 NC_000003.12

OMIM

605163

Protein Summary

Protein general information

O00574

Name: C X C chemokine receptor type 6 (CXC R6) (CXCR 6) (CDw186) (G protein coupled receptor STRL33) (G protein coupled receptor bonzo) (CD antigen CD186)

Length: 342 Mass: 39,280

Tissue specificity: Expressed in lymphoid tissues and activated T cells.

Sequence

MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPL
ADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKV
TSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQ
KHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW
KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL

Structural information

Interpro:	IPR002235 IPR000355 IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001
MINT:	6630856
STRING:	ENSP00000304414;

Other Databases

GeneCards: CXCR6; Malacards: CXCR6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0015026	coreceptor activity	IEA	molecular_function
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular_function
GO:0019079	viral genome replication	TAS	biological_process
GO:0019958	C-X-C chemokine binding	IEA	molecular_function
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004950	chemokine receptor activi ty	IEA	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0015026	coreceptor activity	IEA	molecular_function
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular_function
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular_function
GO:0019079	viral genome replication	TAS	biological_process
GO:0019958	C-X-C chemokine binding	IEA	molecular_function
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0019079	viral genome replication	TAS	biological_process

KEGG pathways

hsa04060 Cytokine-cytokine receptor interaction
hsa04062 Chemokine signaling pathway

Diseases

Associated diseases	References
Endometriosis	PMID: 21773780
Endometriosis	INFBASE21773780

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21773780	Endometrio sis					CXCR6	Show abstract