Endometriosis Knowledgebase

Search Result

Gene id

10803

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CCR9 Gene UCSC Ensembl

Aliases

CC-CKR-9, CDw199, GPR-9-6, GPR28

Gene name

C-C motif chemokine receptor 9

Alternate names

C-C chemokine receptor type 9, G protein-coupled receptor 28, chemokine (C-C motif) receptor 9,

Gene location

3p21.31 (45886503: 45903176) Exons: 5 NC_000003.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the beta chemokine receptor family. It is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are key regulators of the thymocytes migration and maturation in normal and inflammation conditions. The specific ligand of this receptor is CCL25. It has been found that this gene is differentially expressed by T lymphocytes of small intestine and colon, suggested a role in the thymocytes recruitment and development that may permit functional specialization of immune responses in different segment of the gastrointestinal tract. This gene is mapped to the chemokine receptor gene cluster region. Two alternatively spliced transcript variants have been described. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

OMIM

604738

Protein Summary

Protein general information

P51686

Name: C C chemokine receptor type 9 (C C CKR 9) (CC CKR 9) (CCR 9) (G protein coupled receptor 28) (GPR 9 6) (CD antigen CDw199)

Length: 369 Mass: 42,016

Tissue specificity: Highly expressed in the thymus and low in lymph nodes and spleen. {ECO

Sequence

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWY
CTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQ
AMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFL
PFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL

Structural information

Interpro:	IPR004069 IPR000355 IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001
PDB:	5LWE
PDBsum:	5LWE
DIP:	5884
MINT:	106203
STRING:	ENSP00000350256;

Other Databases

GeneCards: CCR9; Malacards: CCR9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006968	cellular defense response	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016493	C-C chemokine receptor ac tivity	IEA	molecular_function
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004950	chemokine receptor activi ty	IEA	molecular_function
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0006968	cellular defense response	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016493	C-C chemokine receptor ac tivity	IEA	molecular_function
GO:0016493	C-C chemokine receptor ac tivity	IEA	molecular_function
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0006968	cellular defense response	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production

Diseases

Associated diseases	References
Celiac disease	PMID: 20190752
Endometriosis	PMID: 20081876
Leukemia	PMID: 20438785
Meningeal neoplasms	PMID: 20406964
Endometriosis	INFBASE20081876

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20081876	Endometrio sis					CCR9 TECK	Show abstract