Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 1081
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary
Gene Symbol CGA   Gene   UCSC   Ensembl
Aliases CG-ALPHA, FSHA, GPHA1, GPHa, HCG, LHA, TSHA
Gene name glycoprotein hormones, alpha polypeptide
Alternate names glycoprotein hormones alpha chain, FSH-alpha, LSH-alpha, TSH-alpha, anterior pituitary glycoprotein hormones common subunit alpha, choriogonadotropin alpha chain, chorionic gonadotrophin subunit alpha, chorionic gonadotropin, alpha polypeptide, follicle-stimulati,
Gene location 6q14.3 (87095146: 87085497)     Exons: 5     NC_000006.12
Gene summary(Entrez) The four human glycoprotein hormones chorionic gonadotropin (CG), luteinizing hormone (LH), follicle stimulating hormone (FSH), and thyroid stimulating hormone (TSH) are dimers consisting of alpha and beta subunits that are associated noncovalently. The alpha subunits of these hormones are identical, however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
OMIM 118850

Protein Summary
Protein general information P01215  

Name: Glycoprotein hormones alpha chain (Anterior pituitary glycoprotein hormones common subunit alpha) (Choriogonadotropin alpha chain) (Chorionic gonadotrophin subunit alpha) (CG alpha) (Follicle stimulating hormone alpha chain) (FSH alpha) (Follitropin alpha

Length: 116  Mass: 13,075

Sequence MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQK
NVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Structural information
Interpro:  IPR029034 IPR000476
Prosite:   PS00779 PS00780 PS50277

Pfam:  		 PF00236

PDB:  		 1DZ7 1E9J 1FL7 1HCN 1HD4 1HRP 1QFW 1XUL 1XWD 4AY9 4MQW
PDBsum:   1DZ7 1E9J 1FL7 1HCN 1HD4 1HRP 1QFW 1XUL 1XWD 4AY9 4MQW

DIP:  		 6182
MINT:   1197885
STRING:   ENSP00000358595;
Other Databases GeneCards:  CGA;  Malacards:  CGA

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0005179 hormone activity
 IMP molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005796 Golgi lumen
 TAS cellular_component
GO:0007165 signal transduction
 TAS biological_process
GO:0007267 cell-cell signaling
 TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
 NAS biological_process
GO:0016486 peptide hormone processin
g
 TAS biological_process
GO:0030335 positive regulation of ce
ll migration
 NAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 NAS biological_process
GO:0005179 hormone activity
 IEA molecular_function
GO:0005179 hormone activity
 IEA molecular_function
GO:0005179 hormone activity
 IMP molecular_function
GO:0005179 hormone activity
 TAS molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005576 extracellular region
 IEA cellular_component
GO:0005576 extracellular region
 IEA cellular_component
GO:0005576 extracellular region
 IEA cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005796 Golgi lumen
 TAS cellular_component
GO:0007165 signal transduction
 TAS biological_process
GO:0007267 cell-cell signaling
 TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
 NAS biological_process
GO:0016486 peptide hormone processin
g
 TAS biological_process
GO:0030335 positive regulation of ce
ll migration
 NAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 NAS biological_process
GO:0005179 hormone activity
 IMP molecular_function
GO:0005179 hormone activity
 TAS molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005576 extracellular region
 TAS cellular_component
GO:0005796 Golgi lumen
 TAS cellular_component
GO:0007165 signal transduction
 TAS biological_process
GO:0007267 cell-cell signaling
 TAS biological_process
GO:0008284 positive regulation of ce
ll proliferation
 NAS biological_process
GO:0016486 peptide hormone processin
g
 TAS biological_process
GO:0030335 positive regulation of ce
ll migration
 NAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 NAS biological_process

KEGG pathways

hsa04080  Neuroactive ligand-receptor interaction
hsa04917  Prolactin signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04912  GnRH signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa05320  Autoimmune thyroid disease
hsa04918  Thyroid hormone synthesis

Diseases

Associated diseases References
Adenomyosis PMID: 7680356
Autism PMID: 19598235
Cancer PMID: 19692168
Chronic obstructive pulmonary disease (COPD) PMID: 19625176
Ectopic endometriosis PMID: 1400884
Ectopic pregnancy PMID: 6965436
Extrauterine pregnancy PMID: 7052392
Female infertility PMID: 25488203
Implantation failure PMID: 18249366
Male infertility PMID: 6601587
Oligomenorrhea PMID: 8183759
Premature ovarian failure(POF) PMID: 8629455
Secondary hyperprolactinaemia PMID: 8183759
Semen quality PMID: 21838882
Endometriosis (ectopic) INFBASE1400884
Spermatogenetic defects PMID: 21838882
Unexplained infertility PMID: 3356777

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
1400884 Endometrio
sis (ectop
ic)
26 (12 normal p
eritoneum from
patients with e
ndometriosis, 1
4 without endom
etriosis)
 Female infertility hCG
LHR
 Show abstract