Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 10850
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CCL27   Gene   UCSC   Ensembl
Aliases ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27
Gene name C-C motif chemokine ligand 27
Alternate names C-C motif chemokine 27, CC chemokine ILC, IL-11 R-alpha-locus chemokine, IL-11 Ralpha-locus chemokine, chemokine (C-C motif) ligand 27, cutaneous T-cell attracting chemokine, skinkine, small inducible cytokine subfamily A (Cys-Cys), member 27, small-inducible cyt,
Gene location 9p13.3 (: )     Exons:     
Gene summary(Entrez) This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. [provided by RefSeq, Sep 2014]
OMIM 604833

Protein Summary

Protein general information Q9Y4X3  

Name: C-C motif chemokine 27 (CC chemokine ILC) (Cutaneous T-cell-attracting chemokine) (CTACK) (ESkine) (IL-11 R-alpha-locus chemokine) (Skinkine) (Small-inducible cytokine A27)

Length: 112  Mass: 12,618

Tissue specificity: Testis, thymus, placenta, ovary and skin.

Sequence MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRS
ICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Structural information
Interpro:  IPR001811 IPR036048

Pfam:  
PF00048

PDB:  
2KUM
PDBsum:   2KUM

DIP:  
5872
STRING:   ENSP00000259631;
Other Databases GeneCards:  CCL27;  Malacards:  CCL27

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0006935 chemotaxis
TAS biological_process
GO:0006955 immune response
IEA biological_process
GO:0007267 cell-cell signaling
TAS biological_process
GO:0008009 chemokine activity
IEA molecular_function
GO:0060326 cell chemotaxis
IEA biological_process
GO:0005125 cytokine activity
IEA molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0006935 chemotaxis
TAS biological_process
GO:0006955 immune response
IEA biological_process
GO:0006955 immune response
TAS biological_process
GO:0007267 cell-cell signaling
TAS biological_process
GO:0008009 chemokine activity
IEA molecular_function
GO:0008009 chemokine activity
TAS molecular_function
GO:0060326 cell chemotaxis
IEA biological_process
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0006935 chemotaxis
TAS biological_process
GO:0006955 immune response
TAS biological_process
GO:0007267 cell-cell signaling
TAS biological_process
GO:0008009 chemokine activity
TAS molecular_function

Diseases

Associated diseases References
Endometriosis PMID: 28433374
Leukemia PMID: 19074885
Endometriosis INFBASE28433374

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28433374 Endometrio
sis

107 female infe
rtility (56 end
ometriosis pati
ents, 38 patien
ts without endo
metriosis)
Female infertility
Show abstract