Endometriosis Knowledgebase

Search Result

Gene id

10850

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CCL27 Gene UCSC Ensembl

Aliases

ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27

Gene name

C-C motif chemokine ligand 27

Alternate names

C-C motif chemokine 27, CC chemokine ILC, IL-11 R-alpha-locus chemokine, IL-11 Ralpha-locus chemokine, chemokine (C-C motif) ligand 27, cutaneous T-cell attracting chemokine, skinkine, small inducible cytokine subfamily A (Cys-Cys), member 27, small-inducible cyt,

Gene location

9p13.3 (: ) Exons:

Gene summary(Entrez)

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. [provided by RefSeq, Sep 2014]

OMIM

604833

Protein Summary

Protein general information

Q9Y4X3

Name: C-C motif chemokine 27 (CC chemokine ILC) (Cutaneous T-cell-attracting chemokine) (CTACK) (ESkine) (IL-11 R-alpha-locus chemokine) (Skinkine) (Small-inducible cytokine A27)

Length: 112 Mass: 12,618

Tissue specificity: Testis, thymus, placenta, ovary and skin.

Sequence

MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRS
ICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG

Structural information

Interpro:	IPR001811 IPR036048
Pfam:	PF00048
PDB:	2KUM
PDBsum:	2KUM
DIP:	5872
STRING:	ENSP00000259631;

Other Databases

GeneCards: CCL27; Malacards: CCL27

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	IEA	molecular_function
GO:0008009	chemokine activity	TAS	molecular_function
GO:0060326	cell chemotaxis	IEA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008009	chemokine activity	TAS	molecular_function

Diseases

Associated diseases	References
Endometriosis	PMID: 28433374
Leukemia	PMID: 19074885
Endometriosis	INFBASE28433374

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28433374	Endometrio sis			107 female infe rtility (56 end ometriosis pati ents, 38 patien ts without endo metriosis)	Female infertility		Show abstract