Endometriosis Knowledgebase

Search Result

Gene id

10855

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HPSE Gene UCSC Ensembl

Aliases

HPA, HPA1, HPR1, HPSE1, HSE1

Gene name

heparanase

Alternate names

heparanase, endo-glucoronidase, heparanase-1,

Gene location

4q21.23 (83335152: 83292460) Exons: 13 NC_000004.12

Gene summary(Entrez)

Heparan sulfate proteoglycans are major components of the basement membrane and extracellular matrix. The protein encoded by this gene is an enzyme that cleaves heparan sulfate proteoglycans to permit cell movement through remodeling of the extracellular matrix. In addition, this cleavage can release bioactive molecules from the extracellular matrix. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

OMIM

604724

Protein Summary

Protein general information

Q9Y251

Name: Heparanase (EC 3.2.1.166) (Endo glucoronidase) (Heparanase 1) (Hpa1) [Cleaved into: Heparanase 8 kDa subunit; Heparanase 50 kDa subunit]

Length: 543 Mass: 61,149

Tissue specificity: Highly expressed in placenta and spleen and weakly expressed in lymph node, thymus, peripheral blood leukocytes, bone marrow, endothelial cells, fetal liver and tumor tissues. Also expressed in hair follicles, specifically in both Henl

Sequence

MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILL
GSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQSQVNQDICKYGSIPPDVEEKLRLEWPYQEQL
LLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNE
PNSFLKKADIFINGSQLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYL
NGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFAAGFMWLDKLGLSARM
GIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLMASVQGSKRRKLRVYLHCTNTDNPRYKEGDL
TLYAINLHNVTKYLRLPYPFSNKQVDKYLLRPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLP
AFSYSFFVIRNAKVAACI

Structural information

Interpro:	IPR005199 IPR017853
Pfam:	PF03662
PDB:	5E8M 5E97 5E98 5E9B 5E9C
PDBsum:	5E8M 5E97 5E98 5E9B 5E9C
STRING:	ENSP00000308107;

Other Databases

GeneCards: HPSE; Malacards: HPSE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004566	beta-glucuronidase activi ty	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005765	lysosomal membrane	IEA	cellular_component
GO:0005975	carbohydrate metabolic pr ocess	IEA	biological_process
GO:0006027	glycosaminoglycan catabol ic process	TAS	biological_process
GO:0006029	proteoglycan metabolic pr ocess	TAS	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0030194	positive regulation of bl ood coagulation	IDA	biological_process
GO:0030200	heparan sulfate proteogly can catabolic process	IDA	biological_process
GO:0030305	heparanase activity	IDA	molecular_function
GO:0030305	heparanase activity	TAS	molecular_function
GO:0033690	positive regulation of os teoblast proliferation	IDA	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0045121	membrane raft	IEA	cellular_component
GO:0045545	syndecan binding	IDA	molecular_function
GO:0046983	protein dimerization acti vity	IDA	molecular_function
GO:0051797	regulation of hair follic le development	IDA	biological_process
GO:0051798	positive regulation of ha ir follicle development	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0061042	vascular wound healing	IEA	biological_process
GO:0004566	beta-glucuronidase activi ty	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005765	lysosomal membrane	IEA	cellular_component
GO:0005975	carbohydrate metabolic pr ocess	IEA	biological_process
GO:0006027	glycosaminoglycan catabol ic process	TAS	biological_process
GO:0006029	proteoglycan metabolic pr ocess	TAS	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0016798	hydrolase activity, actin g on glycosyl bonds	IEA	molecular_function
GO:0030194	positive regulation of bl ood coagulation	IDA	biological_process
GO:0030200	heparan sulfate proteogly can catabolic process	IDA	biological_process
GO:0030305	heparanase activity	IDA	molecular_function
GO:0030305	heparanase activity	TAS	molecular_function
GO:0033690	positive regulation of os teoblast proliferation	IEA	biological_process
GO:0033690	positive regulation of os teoblast proliferation	IDA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0045121	membrane raft	IEA	cellular_component
GO:0045545	syndecan binding	IDA	molecular_function
GO:0046983	protein dimerization acti vity	IDA	molecular_function
GO:0051797	regulation of hair follic le development	IDA	biological_process
GO:0051798	positive regulation of ha ir follicle development	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process
GO:0060055	angiogenesis involved in wound healing	IEA	biological_process
GO:0061042	vascular wound healing	IEA	biological_process
GO:0004566	beta-glucuronidase activi ty	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0006027	glycosaminoglycan catabol ic process	TAS	biological_process
GO:0006029	proteoglycan metabolic pr ocess	TAS	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0030194	positive regulation of bl ood coagulation	IDA	biological_process
GO:0030200	heparan sulfate proteogly can catabolic process	IDA	biological_process
GO:0030305	heparanase activity	IDA	molecular_function
GO:0030305	heparanase activity	TAS	molecular_function
GO:0033690	positive regulation of os teoblast proliferation	IDA	biological_process
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0045545	syndecan binding	IDA	molecular_function
GO:0046983	protein dimerization acti vity	IDA	molecular_function
GO:0051797	regulation of hair follic le development	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IDA	biological_process

KEGG pathways

hsa01100  Metabolic pathways
hsa05205  Proteoglycans in cancer
hsa00531  Glycosaminoglycan degradation

Diseases

Associated diseases	References
Recurrent pregnancy loss (RPL)/ Abortion/ Miscarriage/ Recurrent pregnancy failure/Pregnancy loss/ Recurrent miscarriage/ Spontaneous abortion	PMID: 23907942
Cancer	PMID: 17611567
Endometriosis	PMID: 16762179
Myocardial infarction	PMID: 11798780
Endometriosis	INFBASE14989983
Unexplained miscarriages	PMID: 23907942

PubMed references

PMID	Condition	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
14989983	Endometrio sis		48 (23 patients with endometri osis, 25 eutopi c endometrium o f women without endometriosis)	Female infertility	Heparanase	Show abstract
17481627	Endometrio sis		105 (91 eutopic endometrial sp ecimens, 14 ec topic endometri al specimens)		heparanase-1	Show abstract
16762179	Endometrio sis	235	Hpa (108 (53 ec topic endometri um and 47 eutop ic endometrium specimens in th e EM group, 8 n ormal endometri um specimens in the control gr oup), Ang-2 (12 7 (61 ectopic e ndometrium, 56 eutopic endomet rium specimens in the EM group ,10 normal endo metrium specime		Hpa Ang-2	Show abstract
17141400	Endometrio sis		116 (86 ectopic and eutopic en dometrium of pa tients undergoi ng laparoscopy for endometrios is, 30 normal e ndometrium of p atients undergo ing laparoscopi c tubal ligatio n or hysterosco pic resection b ecause of uteru s septus)		Hpa Ang-2	Show abstract