Endometriosis Knowledgebase

Search Result

Gene id

10857

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PGRMC1 Gene UCSC Ensembl

Aliases

HPR6.6, MPR

Gene name

progesterone receptor membrane component 1

Alternate names

membrane-associated progesterone receptor component 1, progesterone binding protein,

Gene location

Xq24 (119236244: 119244465) Exons: 3 NC_000023.11

Gene summary(Entrez)

This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010]

OMIM

300435

Protein Summary

Protein general information

O00264

Name: Membrane associated progesterone receptor component 1 (mPR)

Length: 195 Mass: 21,671

Tissue specificity: Widely expressed, with highest expression in liver and kidney.

Sequence

MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTP
AELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQ
ETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND

Structural information

Protein Domains	Cytochrome (72-171)
Interpro:	IPR001199
Pfam:	PF00173
PDB:	4X8Y
PDBsum:	4X8Y
MINT:	2997519
STRING:	ENSP00000217971;

Other Databases

GeneCards: PGRMC1; Malacards: PGRMC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005496	steroid binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005730	nucleolus	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0012505	endomembrane system	IBA	cellular_component
GO:0016020	membrane	IBA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0020037	heme binding	IBA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005496	steroid binding	IEA	molecular_function
GO:0005496	steroid binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005730	nucleolus	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0008289	lipid binding	IEA	molecular_function
GO:0012505	endomembrane system	IBA	cellular_component
GO:0016020	membrane	IBA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0020037	heme binding	IBA	molecular_function
GO:0031090	organelle membrane	IEA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005496	steroid binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005730	nucleolus	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0012505	endomembrane system	IBA	cellular_component
GO:0016020	membrane	IBA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0020037	heme binding	IBA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 23793472
Endometriosis	INFBASE23793472
Ovarian follicle development	PMID: 23781168
Polycystic ovary syndrome (PCOS)	PMID: 23781168
Premature ovarian failure ( POF)	PMID: 25246111
Follicular defects	PMID: 23781168

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23793472	Endometrio sis			34 (11 women wi th laparoscopic ally and/or his tologically pro ven stage III/I V endometriosis , 23 disease-fr ee women)		PGRMC-1 PGRMC-2	Show abstract