Endometriosis Knowledgebase

Search Result

Gene id

10859

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

LILRB1 Gene UCSC Ensembl

Aliases

CD85J, ILT-2, ILT2, LIR-1, LIR1, MIR-7, MIR7, PIR-B, PIRB

Gene name

leukocyte immunoglobulin like receptor B1

Alternate names

leukocyte immunoglobulin-like receptor subfamily B member 1, CD85 antigen-like family member J, Ig-like transcript 2, leucocyte Ig-like receptor B1, leukocyte immunoglobulin-like receptor subfamily B member 1 soluble isoform, leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1, monocyte/macrophage immunoglobulin-like receptor 7, myeloid inhibitory receptor 7,

Gene location

19q13.42 (54616929: 54637924) Exons: 16 NC_000019.10

Gene summary(Entrez)

This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

604811

Protein Summary

Protein general information

Q8NHL6

Name: Leukocyte immunoglobulin-like receptor subfamily B member 1 (LIR-1) (Leukocyte immunoglobulin-like receptor 1) (CD85 antigen-like family member J) (Immunoglobulin-like transcript 2) (ILT-2) (Monocyte/macrophage immunoglobulin-like receptor 7) (MIR-7) (CD

Length: 650 Mass: 70,819

Tissue specificity: Expressed predominantly on B-cells and monocytes, and at lower levels on dendritic cells. Detected on a low percentage of T-cells and natural killer (NK) cells. {ECO

Sequence

MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQ
ELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVA
FDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKK
PSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGA
HNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQS
QKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSD
PQSGLGRHLGVVIGILVAVILLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAA
DAQEENLYAAVKHTQPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMD
TEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH

Structural information

Protein Domains	Ig-like (27-115) Ig-like (116-221) Ig-like (222-312) Ig-like (313-409)
Motifs	ITIM motif(531-536) ITIM motif(560-565) ITIM motif(612-617) ITIM motif(642-647)
Interpro:	IPR007110 IPR036179 IPR013783 IPR003599 IPR003598 IPR013151
Prosite:	PS50835
Pfam:	PF00047 PF13895
PDB:	1G0X 1P7Q 1UFU 1UGN 1VDG 3D2U 4LL9 4NO0 5KNM
PDBsum:	1G0X 1P7Q 1UFU 1UGN 1VDG 3D2U 4LL9 4NO0 5KNM
MINT:
STRING:	ENSP00000315997;

Other Databases

GeneCards: LILRB1; Malacards: LILRB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001915	negative regulation of T cell mediated cytotoxicit y	IDA	biological_process
GO:0002230	positive regulation of de fense response to virus b y host	IDA	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002309	T cell proliferation invo lved in immune response	IDA	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0002767	immune response-inhibitin g cell surface receptor s ignaling pathway	NAS	biological_process
GO:0002774	Fc receptor mediated inhi bitory signaling pathway	IDA	biological_process
GO:0005576	extracellular region	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007165	signal transduction	IDA	biological_process
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0009615	response to virus	IDA	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0014063	negative regulation of se rotonin secretion	IDA	biological_process
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030107	HLA-A specific inhibitory MHC class I receptor act ivity	IDA	molecular_function
GO:0030109	HLA-B specific inhibitory MHC class I receptor act ivity	IDA	molecular_function
GO:0031623	receptor internalization	TAS	biological_process
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032609	interferon-gamma producti on	IDA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IDA	biological_process
GO:0032945	negative regulation of mo nonuclear cell proliferat ion	IDA	biological_process
GO:0035548	negative regulation of in terferon-beta secretion	IDA	biological_process
GO:0042130	negative regulation of T cell proliferation	IDA	biological_process
GO:0042169	SH2 domain binding	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IMP	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IMP	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042536	negative regulation of tu mor necrosis factor biosy nthetic process	IDA	biological_process
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0045077	negative regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045806	negative regulation of en docytosis	IDA	biological_process
GO:0045919	positive regulation of cy tolysis	IDA	biological_process
GO:0045919	positive regulation of cy tolysis	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	NAS	biological_process
GO:0045953	negative regulation of na tural killer cell mediate d cytotoxicity	IDA	biological_process
GO:0046636	negative regulation of al pha-beta T cell activatio n	IDA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0051926	negative regulation of ca lcium ion transport	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEP	biological_process
GO:0072643	interferon-gamma secretio n	IDA	biological_process
GO:0097028	dendritic cell differenti ation	IEP	biological_process
GO:2000669	negative regulation of de ndritic cell apoptotic pr ocess	IDA	biological_process
GO:2001180	negative regulation of in terleukin-10 secretion	IDA	biological_process
GO:2001183	negative regulation of in terleukin-12 secretion	IDA	biological_process
GO:2001186	negative regulation of CD 8-positive, alpha-beta T cell activation	IDA	biological_process
GO:2001189	negative regulation of T cell activation via T cel l receptor contact with a ntigen bound to MHC molec ule on antigen presenting cell	IDA	biological_process
GO:2001193	positive regulation of ga mma-delta T cell activati on involved in immune res ponse	IDA	biological_process
GO:2001199	negative regulation of de ndritic cell differentiat ion	IMP	biological_process
GO:2001202	negative regulation of tr ansforming growth factor- beta secretion	IDA	biological_process
GO:2001205	negative regulation of os teoclast development	IDA	biological_process
GO:0001915	negative regulation of T cell mediated cytotoxicit y	IDA	biological_process
GO:0002230	positive regulation of de fense response to virus b y host	IDA	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002309	T cell proliferation invo lved in immune response	IDA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0002767	immune response-inhibitin g cell surface receptor s ignaling pathway	NAS	biological_process
GO:0002774	Fc receptor mediated inhi bitory signaling pathway	IDA	biological_process
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007165	signal transduction	IDA	biological_process
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0009615	response to virus	IDA	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0014063	negative regulation of se rotonin secretion	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030107	HLA-A specific inhibitory MHC class I receptor act ivity	IDA	molecular_function
GO:0030109	HLA-B specific inhibitory MHC class I receptor act ivity	IDA	molecular_function
GO:0031623	receptor internalization	TAS	biological_process
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032609	interferon-gamma producti on	IDA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IDA	biological_process
GO:0032945	negative regulation of mo nonuclear cell proliferat ion	IDA	biological_process
GO:0035548	negative regulation of in terferon-beta secretion	IDA	biological_process
GO:0042130	negative regulation of T cell proliferation	IDA	biological_process
GO:0042169	SH2 domain binding	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IMP	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IMP	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042536	negative regulation of tu mor necrosis factor biosy nthetic process	IDA	biological_process
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0045077	negative regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045806	negative regulation of en docytosis	IDA	biological_process
GO:0045919	positive regulation of cy tolysis	IDA	biological_process
GO:0045919	positive regulation of cy tolysis	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	NAS	biological_process
GO:0045953	negative regulation of na tural killer cell mediate d cytotoxicity	IDA	biological_process
GO:0046636	negative regulation of al pha-beta T cell activatio n	IDA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0051926	negative regulation of ca lcium ion transport	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEP	biological_process
GO:0072643	interferon-gamma secretio n	IDA	biological_process
GO:0097028	dendritic cell differenti ation	IEP	biological_process
GO:2000669	negative regulation of de ndritic cell apoptotic pr ocess	IDA	biological_process
GO:2001180	negative regulation of in terleukin-10 secretion	IDA	biological_process
GO:2001183	negative regulation of in terleukin-12 secretion	IDA	biological_process
GO:2001186	negative regulation of CD 8-positive, alpha-beta T cell activation	IDA	biological_process
GO:2001189	negative regulation of T cell activation via T cel l receptor contact with a ntigen bound to MHC molec ule on antigen presenting cell	IDA	biological_process
GO:2001193	positive regulation of ga mma-delta T cell activati on involved in immune res ponse	IDA	biological_process
GO:2001199	negative regulation of de ndritic cell differentiat ion	IMP	biological_process
GO:2001202	negative regulation of tr ansforming growth factor- beta secretion	IDA	biological_process
GO:2001205	negative regulation of os teoclast development	IDA	biological_process
GO:0001915	negative regulation of T cell mediated cytotoxicit y	IDA	biological_process
GO:0002230	positive regulation of de fense response to virus b y host	IDA	biological_process
GO:0002309	T cell proliferation invo lved in immune response	IDA	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0002767	immune response-inhibitin g cell surface receptor s ignaling pathway	NAS	biological_process
GO:0002774	Fc receptor mediated inhi bitory signaling pathway	IDA	biological_process
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0007165	signal transduction	IDA	biological_process
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0008157	protein phosphatase 1 bin ding	IPI	molecular_function
GO:0009615	response to virus	IDA	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0014063	negative regulation of se rotonin secretion	IDA	biological_process
GO:0030107	HLA-A specific inhibitory MHC class I receptor act ivity	IDA	molecular_function
GO:0030109	HLA-B specific inhibitory MHC class I receptor act ivity	IDA	molecular_function
GO:0031623	receptor internalization	TAS	biological_process
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032393	MHC class I receptor acti vity	IDA	molecular_function
GO:0032609	interferon-gamma producti on	IDA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IDA	biological_process
GO:0032945	negative regulation of mo nonuclear cell proliferat ion	IDA	biological_process
GO:0035548	negative regulation of in terferon-beta secretion	IDA	biological_process
GO:0042130	negative regulation of T cell proliferation	IDA	biological_process
GO:0042169	SH2 domain binding	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IMP	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042288	MHC class I protein bindi ng	IMP	molecular_function
GO:0042288	MHC class I protein bindi ng	IPI	molecular_function
GO:0042288	MHC class I protein bindi ng	IDA	molecular_function
GO:0042536	negative regulation of tu mor necrosis factor biosy nthetic process	IDA	biological_process
GO:0042803	protein homodimerization activity	IPI	molecular_function
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0045077	negative regulation of in terferon-gamma biosynthet ic process	IDA	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045806	negative regulation of en docytosis	IDA	biological_process
GO:0045919	positive regulation of cy tolysis	IDA	biological_process
GO:0045919	positive regulation of cy tolysis	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	NAS	biological_process
GO:0045953	negative regulation of na tural killer cell mediate d cytotoxicity	IDA	biological_process
GO:0046636	negative regulation of al pha-beta T cell activatio n	IDA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0051926	negative regulation of ca lcium ion transport	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEP	biological_process
GO:0072643	interferon-gamma secretio n	IDA	biological_process
GO:0097028	dendritic cell differenti ation	IEP	biological_process
GO:2000669	negative regulation of de ndritic cell apoptotic pr ocess	IDA	biological_process
GO:2001180	negative regulation of in terleukin-10 secretion	IDA	biological_process
GO:2001183	negative regulation of in terleukin-12 secretion	IDA	biological_process
GO:2001186	negative regulation of CD 8-positive, alpha-beta T cell activation	IDA	biological_process
GO:2001189	negative regulation of T cell activation via T cel l receptor contact with a ntigen bound to MHC molec ule on antigen presenting cell	IDA	biological_process
GO:2001193	positive regulation of ga mma-delta T cell activati on involved in immune res ponse	IDA	biological_process
GO:2001199	negative regulation of de ndritic cell differentiat ion	IMP	biological_process
GO:2001202	negative regulation of tr ansforming growth factor- beta secretion	IDA	biological_process
GO:2001205	negative regulation of os teoclast development	IDA	biological_process

KEGG pathways

hsa04380 Osteoclast differentiation

Diseases

Associated diseases	References
Lupus erythematosus	GAD16014635
Diabetes	GAD20628086
Endometriosis	PubMed29234882

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
29234882	Endometrio sis	HLA-G rs1233334, LILRB1 rs41308748:AA and LILRB2 rs383369		590(276 patient s with endometr iosis, 314 heal thy fertile wom en)		HLA-G KIR2DL4 �LILRB1�and LILRB2	Show abstract