Endometriosis Knowledgebase

Search Result

Gene id

11009

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL24 Gene UCSC Ensembl

Aliases

C49A, FISP, IL10B, MDA7, MOB5, ST16

Gene name

interleukin 24

Alternate names

interleukin-24, IL-4-induced secreted protein, melanocyte-associated Mda-7, melanoma differentiation-associated gene 7 protein, suppression of tumorigenicity 16 (melanoma differentiation),

Gene location

1q32.1 (206897403: 206904138) Exons: 7 NC_000001.11

Gene summary(Entrez)

This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

OMIM

604136

Protein Summary

Protein general information

Q13007

Name: Interleukin-24 (IL-24) (Melanoma differentiation-associated gene 7 protein) (MDA-7) (Suppression of tumorigenicity 16 protein)

Length: 206 Mass: 23,825

Tissue specificity: Up-regulated in melanoma cells induced to terminally differentiate.

Sequence

MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWA
VKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQ
LQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Structural information

Interpro:	IPR009079 IPR020423 IPR020444
Prosite:	PS00520
MINT:
STRING:	ENSP00000375795;

Other Databases

GeneCards: IL24; Malacards: IL24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006915	apoptotic process	IEA	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0030336	negative regulation of ce ll migration	IEA	biological_process
GO:0033136	serine phosphorylation of STAT3 protein	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IBA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071353	cellular response to inte rleukin-4	IEA	biological_process
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0030336	negative regulation of ce ll migration	IEA	biological_process
GO:0033136	serine phosphorylation of STAT3 protein	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IBA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071353	cellular response to inte rleukin-4	IEA	biological_process
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	IBA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IBA	biological_process

KEGG pathways

hsa04630 Jak-STAT signaling pathway
hsa04060 Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Endometriosis	INFBASE27624484

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27624484	Endometrio sis						Show abstract