Endometriosis Knowledgebase

Search Result

Gene id

11040

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PIM2 Gene UCSC Ensembl

Gene name

Pim-2 proto-oncogene, serine/threonine kinase

Alternate names

serine/threonine-protein kinase pim-2, pim-2 oncogene, pim-2h, proto-oncogene Pim-2 (serine threonine kinase),

Gene location

Xp11.23 (48919135: 48913181) Exons: 6 NC_000023.11

Gene summary(Entrez)

This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.[provided by RefSeq, Nov 2009]

OMIM

300295

Protein Summary

Protein general information

Q9P1W9

Name: Serine/threonine protein kinase pim 2 (EC 2.7.11.1) (Pim 2h)

Length: 311 Mass: 34,190

Tissue specificity: Highly expressed in hematopoietic tissues, in leukemic and lymphoma cell lines, testis, small intestine, colon and colorectal adenocarcinoma cells. Weakly expressed in normal liver, but highly expressed in hepatocellular carcinoma tiss

Sequence

MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWSPLS
DSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAA
IQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLG
ILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP

Structural information

Protein Domains	Protein (32-286)
Interpro:	IPR011009 IPR017348 IPR000719 IPR017441 IPR008271
Prosite:	PS00107 PS50011 PS00108
Pfam:	PF00069
PDB:	2IWI 4X7Q
PDBsum:	2IWI 4X7Q
MINT:	1432143
STRING:	ENSP00000365692;

Other Databases

GeneCards: PIM2; Malacards: PIM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005737	cytoplasm	IBA	cellular_component
GO:0006468	protein phosphorylation	ISS	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007140	male meiosis	TAS	biological_process
GO:0007346	regulation of mitotic cel l cycle	IBA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0010508	positive regulation of au tophagy	ISS	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046777	protein autophosphorylati on	IBA	biological_process
GO:0050821	protein stabilization	ISS	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005737	cytoplasm	IBA	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	ISS	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007140	male meiosis	TAS	biological_process
GO:0007346	regulation of mitotic cel l cycle	IBA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0010508	positive regulation of au tophagy	ISS	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046777	protein autophosphorylati on	IBA	biological_process
GO:0050821	protein stabilization	ISS	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IBA	cellular_component
GO:0006468	protein phosphorylation	ISS	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006468	protein phosphorylation	TAS	biological_process
GO:0007140	male meiosis	TAS	biological_process
GO:0007346	regulation of mitotic cel l cycle	IBA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0010508	positive regulation of au tophagy	ISS	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	ISS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046777	protein autophosphorylati on	IBA	biological_process
GO:0050821	protein stabilization	ISS	biological_process
GO:0050821	protein stabilization	IMP	biological_process

KEGG pathways

hsa05221 Acute myeloid leukemia

Diseases

Associated diseases	References
Endometriosis	PMID: 16249290
Endometriosis	INFBASE16249290

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16249290	Endometrio sis			30 (15 patients undergoing lap aroscopy or hys terectomy for e ndometriosis, 1 5 controls)		IGFBP5 PIM2 RPL41 PSAP FBLN1 SIPL DLX5 HSD11B2 SET and RHOE	Show abstract