Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 11156
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol PTP4A3   Gene   UCSC   Ensembl
Aliases PRL-3, PRL-R, PRL3
Gene name protein tyrosine phosphatase type IVA, member 3
Alternate names protein tyrosine phosphatase type IVA 3, potentially prenylated protein tyrosine phosphatase, protein-tyrosine phosphatase 4a3, protein-tyrosine phosphatase of regenerating liver 3,
Gene location 8q24.3 (141391992: 141432453)     Exons: 9     NC_000008.11
Gene summary(Entrez) This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
OMIM 606449

Protein Summary

Protein general information O75365  

Name: Protein tyrosine phosphatase type IVA 3 (EC 3.1.3.48) (PRL R) (Protein tyrosine phosphatase 4a3) (Protein tyrosine phosphatase of regenerating liver 3) (PRL 3)

Length: 173  Mass: 19,535

Tissue specificity: Mainly expressed in cardiomyocytes and skeletal muscle; also found in pancreas. Consistently overexpressed in colon cancer metastasis. {ECO

Sequence MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAP
PPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLE
KYRPKQRLRFKDPHTHKTRCCVM
Structural information
Protein Domains
Tyrosine-protein (82-148)
Interpro:  IPR000340 IPR029021 IPR003595 IPR000387
Prosite:   PS50056

Pfam:  
PF00782

PDB:  
1R6H 1V3A 2MBC 5TSR
PDBsum:   1R6H 1V3A 2MBC 5TSR
STRING:   ENSP00000332274;
Other Databases GeneCards:  PTP4A3;  Malacards:  PTP4A3

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0004727 prenylated protein tyrosi
ne phosphatase activity
TAS molecular_function
GO:0005634 nucleus
IBA cellular_component
GO:0005737 cytoplasm
IBA cellular_component
GO:0005769 early endosome
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0007219 Notch signaling pathway
IEA biological_process
GO:0008138 protein tyrosine/serine/t
hreonine phosphatase acti
vity
IEA molecular_function
GO:0035335 peptidyl-tyrosine dephosp
horylation
IEA biological_process
GO:0043117 positive regulation of va
scular permeability
IEA biological_process
GO:0043542 endothelial cell migratio
n
IMP biological_process
GO:1900746 regulation of vascular en
dothelial growth factor s
ignaling pathway
IEA biological_process
GO:0004721 phosphoprotein phosphatas
e activity
IEA molecular_function
GO:0004725 protein tyrosine phosphat
ase activity
IEA molecular_function
GO:0004727 prenylated protein tyrosi
ne phosphatase activity
TAS molecular_function
GO:0005634 nucleus
IBA cellular_component
GO:0005737 cytoplasm
IBA cellular_component
GO:0005768 endosome
IEA cellular_component
GO:0005769 early endosome
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0006470 protein dephosphorylation
IEA biological_process
GO:0007219 Notch signaling pathway
IEA biological_process
GO:0008138 protein tyrosine/serine/t
hreonine phosphatase acti
vity
IEA molecular_function
GO:0016020 membrane
IEA cellular_component
GO:0016311 dephosphorylation
IEA biological_process
GO:0016787 hydrolase activity
IEA molecular_function
GO:0016791 phosphatase activity
IEA molecular_function
GO:0035335 peptidyl-tyrosine dephosp
horylation
IEA biological_process
GO:0043117 positive regulation of va
scular permeability
IEA biological_process
GO:0043542 endothelial cell migratio
n
IEA biological_process
GO:0043542 endothelial cell migratio
n
IMP biological_process
GO:1900746 regulation of vascular en
dothelial growth factor s
ignaling pathway
IEA biological_process
GO:0004727 prenylated protein tyrosi
ne phosphatase activity
TAS molecular_function
GO:0005634 nucleus
IBA cellular_component
GO:0005737 cytoplasm
IBA cellular_component
GO:0043542 endothelial cell migratio
n
IMP biological_process

Diseases

Associated diseases References
Endometriosis PMID: 20045518
Endometriosis INFBASE20045518

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
20045518 Endometrio
sis

155 (105 women
with histopath
ologically conf
irmed endometri
osis, 50 women
with histopatho
logically asses
sed normal endo
metria)
PRL-3
Show abstract