Endometriosis Knowledgebase

Search Result

Gene id

11156

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PTP4A3 Gene UCSC Ensembl

Aliases

PRL-3, PRL-R, PRL3

Gene name

protein tyrosine phosphatase type IVA, member 3

Alternate names

protein tyrosine phosphatase type IVA 3, potentially prenylated protein tyrosine phosphatase, protein-tyrosine phosphatase 4a3, protein-tyrosine phosphatase of regenerating liver 3,

Gene location

8q24.3 (141391992: 141432453) Exons: 9 NC_000008.11

Gene summary(Entrez)

This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice demonstrates that they are prenylated in vivo, suggesting their association with cell plasma membrane. The encoded protein may enhance cell proliferation, and overexpression of this gene has been implicated in tumor metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

OMIM

606449

Protein Summary

Protein general information

O75365

Name: Protein tyrosine phosphatase type IVA 3 (EC 3.1.3.48) (PRL R) (Protein tyrosine phosphatase 4a3) (Protein tyrosine phosphatase of regenerating liver 3) (PRL 3)

Length: 173 Mass: 19,535

Tissue specificity: Mainly expressed in cardiomyocytes and skeletal muscle; also found in pancreas. Consistently overexpressed in colon cancer metastasis. {ECO

Sequence

MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAP
PPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLE
KYRPKQRLRFKDPHTHKTRCCVM

Structural information

Protein Domains	Tyrosine-protein (82-148)
Interpro:	IPR000340 IPR029021 IPR003595 IPR000387
Prosite:	PS50056
Pfam:	PF00782
PDB:	1R6H 1V3A 2MBC 5TSR
PDBsum:	1R6H 1V3A 2MBC 5TSR
STRING:	ENSP00000332274;

Other Databases

GeneCards: PTP4A3; Malacards: PTP4A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004727	prenylated protein tyrosi ne phosphatase activity	TAS	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0008138	protein tyrosine/serine/t hreonine phosphatase acti vity	IEA	molecular_function
GO:0035335	peptidyl-tyrosine dephosp horylation	IEA	biological_process
GO:0043117	positive regulation of va scular permeability	IEA	biological_process
GO:0043542	endothelial cell migratio n	IMP	biological_process
GO:1900746	regulation of vascular en dothelial growth factor s ignaling pathway	IEA	biological_process
GO:0004721	phosphoprotein phosphatas e activity	IEA	molecular_function
GO:0004725	protein tyrosine phosphat ase activity	IEA	molecular_function
GO:0004727	prenylated protein tyrosi ne phosphatase activity	TAS	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006470	protein dephosphorylation	IEA	biological_process
GO:0007219	Notch signaling pathway	IEA	biological_process
GO:0008138	protein tyrosine/serine/t hreonine phosphatase acti vity	IEA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016311	dephosphorylation	IEA	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0016791	phosphatase activity	IEA	molecular_function
GO:0035335	peptidyl-tyrosine dephosp horylation	IEA	biological_process
GO:0043117	positive regulation of va scular permeability	IEA	biological_process
GO:0043542	endothelial cell migratio n	IEA	biological_process
GO:0043542	endothelial cell migratio n	IMP	biological_process
GO:1900746	regulation of vascular en dothelial growth factor s ignaling pathway	IEA	biological_process
GO:0004727	prenylated protein tyrosi ne phosphatase activity	TAS	molecular_function
GO:0005634	nucleus	IBA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0043542	endothelial cell migratio n	IMP	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 20045518
Endometriosis	INFBASE20045518

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20045518	Endometrio sis			155 (105 women with histopath ologically conf irmed endometri osis, 50 women with histopatho logically asses sed normal endo metria)		PRL-3	Show abstract