Endometriosis Knowledgebase

Search Result

Gene id

11200

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CHEK2 Gene UCSC Ensembl

Aliases

CDS1, CHK2, HuCds1, LFS2, PP1425, RAD53, hCds1

Gene name

checkpoint kinase 2

Alternate names

serine/threonine-protein kinase Chk2, CHK2 checkpoint homolog, cds1 homolog, checkpoint-like protein CHK2,

Gene location

22q12.1 (28741865: 28687742) Exons: 22 NC_000022.11

Gene summary(Entrez)

In response to DNA damage and replication blocks, cell cycle progression is halted through the control of critical cell cycle regulators. The protein encoded by this gene is a cell cycle checkpoint regulator and putative tumor suppressor. It contains a forkhead-associated protein interaction domain essential for activation in response to DNA damage and is rapidly phosphorylated in response to replication blocks and DNA damage. When activated, the encoded protein is known to inhibit CDC25C phosphatase, preventing entry into mitosis, and has been shown to stabilize the tumor suppressor protein p53, leading to cell cycle arrest in G1. In addition, this protein interacts with and phosphorylates BRCA1, allowing BRCA1 to restore survival after DNA damage. Mutations in this gene have been linked with Li-Fraumeni syndrome, a highly penetrant familial cancer phenotype usually associated with inherited mutations in TP53. Also, mutations in this gene are thought to confer a predisposition to sarcomas, breast cancer, and brain tumors. This nuclear protein is a member of the CDS1 subfamily of serine/threonine protein kinases. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

OMIM

604373

Protein Summary

Protein general information

O96017

Name: Serine/threonine protein kinase Chk2 (EC 2.7.11.1) (CHK2 checkpoint homolog) (Cds1 homolog) (Hucds1) (hCds1) (Checkpoint kinase 2)

Length: 543 Mass: 60,915

Tissue specificity: High expression is found in testis, spleen, colon and peripheral blood leukocytes. Low expression is found in other tissues.

Sequence

MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIP
EDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREV
GPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKT
LGSGACGEVKLAFERKTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIV
LELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKIL
GETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPE
VWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQPSTSRKRPREG
EAEGAETTKRPAVCAAVL

Structural information

Protein Domains	FHA. (113-175) Protein (220-486)
Interpro:	IPR020636 IPR000253 IPR011009 IPR000719 IPR008271 IPR008984
Prosite:	PS50006 PS50011 PS00108
Pfam:	PF00498 PF00069
PDB:	1GXC 2CN5 2CN8 2W0J 2W7X 2WTC 2WTD 2WTI 2WTJ 2XBJ 2XK9 2XM8 2XM9 2YCF 2YCQ 2YCR 2YCS 2YIQ 2YIR 2YIT 3I6U 3I6W 3VA4 4A9R 4A9S 4A9T 4A9U 4BDA 4BDB 4BDC 4BDD 4BDE 4BDF 4BDG 4BDH 4BDI 4BDJ 4BDK
PDBsum:	1GXC 2CN5 2CN8 2W0J 2W7X 2WTC 2WTD 2WTI 2WTJ 2XBJ 2XK9 2XM8 2XM9 2YCF 2YCQ 2YCR 2YCS 2YIQ 2YIR 2YIT 3I6U 3I6W 3VA4 4A9R 4A9S 4A9T 4A9U 4BDA 4BDB 4BDC 4BDD 4BDE 4BDF 4BDG 4BDH 4BDI 4BDJ 4BDK
DIP:	24270
MINT:	124588

Other Databases

GeneCards: CHEK2; Malacards: CHEK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000077	DNA damage checkpoint	TAS	biological_process
GO:0000077	DNA damage checkpoint	TAS	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IMP	biological_process
GO:0001302	replicative cell aging	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0006975	DNA damage induced protei n phosphorylation	IMP	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IDA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IMP	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IMP	biological_process
GO:0010332	response to gamma radiati on	IEA	biological_process
GO:0016605	PML body	IDA	cellular_component
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0035690	cellular response to drug	IEA	biological_process
GO:0042176	regulation of protein cat abolic process	IMP	biological_process
GO:0042770	signal transduction in re sponse to DNA damage	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0044257	cellular protein cataboli c process	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050821	protein stabilization	IDA	biological_process
GO:0051301	cell division	IEA	biological_process
GO:0071157	negative regulation of ce ll cycle arrest	IEA	biological_process
GO:0072428	signal transduction invol ved in intra-S DNA damage checkpoint	IMP	biological_process
GO:0090307	mitotic spindle assembly	IMP	biological_process
GO:0090399	replicative senescence	NAS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1902520	response to doxorubicin	IEA	biological_process
GO:1903926	cellular response to bisp henol A	IEA	biological_process
GO:2000002	negative regulation of DN A damage checkpoint	IEA	biological_process
GO:2000210	positive regulation of an oikis	IEA	biological_process
GO:0000781	chromosome, telomeric reg ion	IDA	cellular_component
GO:0000077	DNA damage checkpoint	IEA	biological_process
GO:0000077	DNA damage checkpoint	TAS	biological_process
GO:0000077	DNA damage checkpoint	TAS	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IMP	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0001302	replicative cell aging	IMP	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005654	nucleoplasm	IEA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006281	DNA repair	IEA	biological_process
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0006975	DNA damage induced protei n phosphorylation	IMP	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0007049	cell cycle	IEA	biological_process
GO:0007067	mitotic nuclear division	IEA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IDA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IMP	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IMP	biological_process
GO:0010332	response to gamma radiati on	IEA	biological_process
GO:0016301	kinase activity	IEA	molecular_function
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016605	PML body	IEA	cellular_component
GO:0016605	PML body	IDA	cellular_component
GO:0016740	transferase activity	IEA	molecular_function
GO:0018105	peptidyl-serine phosphory lation	IEA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0035690	cellular response to drug	IEA	biological_process
GO:0042176	regulation of protein cat abolic process	IMP	biological_process
GO:0042770	signal transduction in re sponse to DNA damage	IEA	biological_process
GO:0042770	signal transduction in re sponse to DNA damage	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0044257	cellular protein cataboli c process	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0050821	protein stabilization	IDA	biological_process
GO:0051301	cell division	IEA	biological_process
GO:0071157	negative regulation of ce ll cycle arrest	IEA	biological_process
GO:0072428	signal transduction invol ved in intra-S DNA damage checkpoint	IMP	biological_process
GO:0090307	mitotic spindle assembly	IMP	biological_process
GO:0090399	replicative senescence	NAS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1902520	response to doxorubicin	IEA	biological_process
GO:1903926	cellular response to bisp henol A	IEA	biological_process
GO:2000002	negative regulation of DN A damage checkpoint	IEA	biological_process
GO:2000210	positive regulation of an oikis	IEA	biological_process
GO:0000781	chromosome, telomeric reg ion	IDA	cellular_component
GO:0000077	DNA damage checkpoint	TAS	biological_process
GO:0000077	DNA damage checkpoint	TAS	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	IMP	biological_process
GO:0001302	replicative cell aging	IMP	biological_process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005794	Golgi apparatus	IDA	cellular_component
GO:0006302	double-strand break repai r	IMP	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0006974	cellular response to DNA damage stimulus	TAS	biological_process
GO:0006975	DNA damage induced protei n phosphorylation	IMP	biological_process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IDA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IMP	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IMP	biological_process
GO:0016605	PML body	IDA	cellular_component
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0042176	regulation of protein cat abolic process	IMP	biological_process
GO:0042770	signal transduction in re sponse to DNA damage	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0044257	cellular protein cataboli c process	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0072428	signal transduction invol ved in intra-S DNA damage checkpoint	IMP	biological_process
GO:0090307	mitotic spindle assembly	IMP	biological_process
GO:0090399	replicative senescence	NAS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:0000781	chromosome, telomeric reg ion	IDA	cellular_component

KEGG pathways

hsa05166  HTLV-I infection
hsa04110  Cell cycle
hsa04115  p53 signaling pathway

Diseases

Associated diseases	References
Atherosclerosis	PMID: 19265784
Cancer	PMID: 20729852
Diabetes	PMID: 19855918
Endometriosis	PMID: 25912412
Endometriosis	INFBASE25912412

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25912412	Endometrio sis			179 (59 endomet rioid cancers, 36 clear cell c ases, 18 contig uous endometrio sis cases, 66 b enign endometri otic ovarian cy sts)		BAF250a AKT ?H2AX BIM BAX ATM CHK2 Bcl2	Show abstract