Endometriosis Knowledgebase

Search Result

Gene id

11270

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

NRM Gene UCSC Ensembl

Aliases

NRM29

Gene name

nurim

Alternate names

nurim, nuclear rim protein, nurim (nuclear envelope membrane protein),

Gene location

6p21.33 (30691419: 30688046) Exons: 7 NC_000006.12

Gene summary(Entrez)

The protein encoded by this gene contains transmembrane domains and resides within the inner nuclear membrane, where it is tightly associated with the nucleus. This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]

Protein Summary

Protein general information

Q8IXM6

Name: Nurim (Nuclear envelope membrane protein) (Nuclear rim protein)

Length: 262 Mass: 29,379

Sequence

MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLLLLFVG
QHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIPKGPVLWEARAEPWATWVPLLCFVLHVISWL
LIFSILLVFDYAELMGLKQVYYHVLGLGEPLALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLAFLLT
LYLGLAHGLDQQDLRYLRAQLQRKLHLLSRPQDGEAE

Structural information

Interpro:	IPR033580
STRING:	ENSP00000259953;

Other Databases

GeneCards: NRM; Malacards: NRM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003674	molecular_function	ND	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005637	nuclear inner membrane	IEA	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0003674	molecular_function	ND	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0005637	nuclear inner membrane	IEA	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0003674	molecular_function	ND	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005635	nuclear envelope	IDA	cellular_component
GO:0008150	biological_process	ND	biological_process
GO:0016020	membrane	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis (ovarian)	PMID: 16815388
Ovarian endometriosis	INFBASE16815388
Rheumatoid arthritis	PMID: 19950296
Systemic lupus erythematosus	PMID: 19851445

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16815388	Endometrio sis (ovari an)			12 infertile pa tients (6 patie nts during the proliferative p hase and 6 duri ng the secretor y phase)	Female infertility	PDGFRA PKCbeta1 JAK1 HSP90A COUP-TF2 MOR 17betaHSD2 Sprouty2 and PGE(2)EP3	Show abstract