Endometriosis Knowledgebase

Search Result

Gene id

112744

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL17F Gene UCSC Ensembl

Aliases

CANDF6, IL-17F, ML-1, ML1

Gene name

interleukin 17F

Alternate names

interleukin-17F, cytokine ML-1,

Gene location

6p12.2 (52245688: 52236680) Exons: 4 NC_000006.12

Gene summary(Entrez)

The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq, Jul 2008]

OMIM

606496

Protein Summary

Protein general information

Q96PD4

Name: Interleukin 17F (IL 17F) (Cytokine ML 1)

Length: 163 Mass: 18,045

Tissue specificity: Expressed in activated, but not resting, CD4+ T-cells and activated monocytes.

Sequence

MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIE
SRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTV
GCTCVTPVIHHVQ

Structural information

Interpro:	IPR029034 IPR020440 IPR010345
Pfam:	PF06083
PDB:	1JPY 3JVF
PDBsum:	1JPY 3JVF
STRING:	ENSP00000337432;

Other Databases

GeneCards: IL17F; Malacards: IL17F

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005126	cytokine receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006954	inflammatory response	IBA	biological_process
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0017015	regulation of transformin g growth factor beta rece ptor signaling pathway	IDA	biological_process
GO:0019955	cytokine binding	IDA	molecular_function
GO:0042089	cytokine biosynthetic pro cess	IDA	biological_process
GO:0042109	lymphotoxin A biosyntheti c process	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0045076	regulation of interleukin -2 biosynthetic process	IDA	biological_process
GO:0045408	regulation of interleukin -6 biosynthetic process	IDA	biological_process
GO:0045414	regulation of interleukin -8 biosynthetic process	IDA	biological_process
GO:0045423	regulation of granulocyte macrophage colony-stimul ating factor biosynthetic process	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0051216	cartilage development	IDA	biological_process
GO:1900017	positive regulation of cy tokine production involve d in inflammatory respons e	IEA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IEA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005126	cytokine receptor binding	IEA	molecular_function
GO:0005126	cytokine receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0017015	regulation of transformin g growth factor beta rece ptor signaling pathway	IDA	biological_process
GO:0019955	cytokine binding	IDA	molecular_function
GO:0042089	cytokine biosynthetic pro cess	IDA	biological_process
GO:0042109	lymphotoxin A biosyntheti c process	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0045076	regulation of interleukin -2 biosynthetic process	IDA	biological_process
GO:0045408	regulation of interleukin -6 biosynthetic process	IDA	biological_process
GO:0045414	regulation of interleukin -8 biosynthetic process	IDA	biological_process
GO:0045423	regulation of granulocyte macrophage colony-stimul ating factor biosynthetic process	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0051216	cartilage development	IDA	biological_process
GO:1900017	positive regulation of cy tokine production involve d in inflammatory respons e	IEA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IEA	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005126	cytokine receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006954	inflammatory response	IBA	biological_process
GO:0016525	negative regulation of an giogenesis	IDA	biological_process
GO:0017015	regulation of transformin g growth factor beta rece ptor signaling pathway	IDA	biological_process
GO:0019955	cytokine binding	IDA	molecular_function
GO:0042089	cytokine biosynthetic pro cess	IDA	biological_process
GO:0042109	lymphotoxin A biosyntheti c process	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0045076	regulation of interleukin -2 biosynthetic process	IDA	biological_process
GO:0045408	regulation of interleukin -6 biosynthetic process	IDA	biological_process
GO:0045414	regulation of interleukin -8 biosynthetic process	IDA	biological_process
GO:0045423	regulation of granulocyte macrophage colony-stimul ating factor biosynthetic process	IDA	biological_process
GO:0051216	cartilage development	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04659  Th17 cell differentiation
hsa04657  IL-17 signaling pathway
hsa05321  Inflammatory bowel disease

Diseases

Associated diseases	References
Cancer	PMID: 22142827
Crohn's disease	PMID: 18088064
Endometriosis	PMID: 21601196
Endometriosis	INFBASE21601196
Ulcerative colitis	PMID: 17828618

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21601196	Endometrio sis					IL-17F IL-8 COX2 �	Show abstract
21601196	Endometrio sis					IL-17F IL-8 COX2	Show abstract