Endometriosis Knowledgebase

Search Result

Gene id

11315

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

PARK7 Gene UCSC Ensembl

Aliases

DJ-1, DJ1, GATD2, HEL-S-67p

Gene name

Parkinsonism associated deglycase

Alternate names

protein DJ-1, protein deglycase DJ-1, Parkinson disease (autosomal recessive, early onset) 7, epididymis secretory sperm binding protein Li 67p, oncogene DJ1, parkinson protein 7,

Gene location

1p36.23 (7961653: 7985281) Exons: 8 NC_000001.11

Gene summary(Entrez)

The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]

OMIM

602533

Protein Summary

Protein general information

Q99497

Name: Protein DJ 1 (DJ 1) (Oncogene DJ1) (Parkinson disease protein 7) (Parkinsonism associated deglycase) (Protein deglycase DJ 1) (EC 3.1.2. ) (EC 3.5.1.124)

Length: 189 Mass: 19,891

Tissue specificity: Highly expressed in pancreas, kidney, skeletal muscle, liver, testis and heart. Detected at slightly lower levels in placenta and brain (at protein level). Detected in astrocytes, Sertoli cells, spermatogonia, spermatids and spermatozo

Sequence

MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGG
NLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYTYSENRVEKDG
LILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD

Structural information

Interpro:	IPR029062 IPR002818 IPR006287
Pfam:	PF01965
PDB:	1J42 1P5F 1PDV 1PDW 1PE0 1Q2U 1SOA 1UCF 2OR3 2R1T 2R1U 2R1V 2RK3 2RK4 2RK6 3B36 3B38 3B3A 3BWE 3CY6 3CYF 3CZ9 3CZA 3EZG 3F71 3SF8 4BTE 4MNT 4MTC 4N0M 4N12 4OGF 4OQ4 4P2G 4P34 4P35 4P36 4RKW 4RKY 4S0Z 4ZGG 5IP5 5SY6 5SY9 5SYA
PDBsum:	1J42 1P5F 1PDV 1PDW 1PE0 1Q2U 1SOA 1UCF 2OR3 2R1T 2R1U 2R1V 2RK3 2RK4 2RK6 3B36 3B38 3B3A 3BWE 3CY6 3CYF 3CZ9 3CZA 3EZG 3F71 3SF8 4BTE 4MNT 4MTC 4N0M 4N12 4OGF 4OQ4 4P2G 4P34 4P35 4P36 4RKW 4RKY 4S0Z 4ZGG 5IP5 5SY6 5SY9 5SYA
DIP:	35515
MINT:	5003468
STRING:	ENSP00000340278;

Other Databases

GeneCards: PARK7; Malacards: PARK7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000785	chromatin	IDA	cellular_component
GO:0001933	negative regulation of pr otein phosphorylation	IGI	biological_process
GO:0003713	transcription coactivator activity	IGI	molecular_function
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0003729	mRNA binding	IDA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IMP	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005758	mitochondrial intermembra ne space	IEA	cellular_component
GO:0005759	mitochondrial matrix	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IMP	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IGI	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006517	protein deglycosylation	IDA	biological_process
GO:0006914	autophagy	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0007005	mitochondrion organizatio n	ISS	biological_process
GO:0007265	Ras protein signal transd uction	TAS	biological_process
GO:0007338	single fertilization	IEA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008233	peptidase activity	IDA	molecular_function
GO:0008344	adult locomotory behavior	IEA	biological_process
GO:0010273	detoxification of copper ion	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	TAS	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0016532	superoxide dismutase copp er chaperone activity	IDA	molecular_function
GO:0016605	PML body	IDA	cellular_component
GO:0016684	oxidoreductase activity, acting on peroxide as acc eptor	IDA	molecular_function
GO:0018323	enzyme active site format ion via L-cysteine sulfin ic acid	IEA	biological_process
GO:0019172	glyoxalase III activity	IDA	molecular_function
GO:0019243	methylglyoxal catabolic p rocess to D-lactate via S -lactoyl-glutathione	IDA	biological_process
GO:0019249	lactate biosynthetic proc ess	IEA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019900	kinase binding	IPI	molecular_function
GO:0019955	cytokine binding	IPI	molecular_function
GO:0030424	axon	ISS	cellular_component
GO:0031397	negative regulation of pr otein ubiquitination	IDA	biological_process
GO:0031397	negative regulation of pr otein ubiquitination	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IGI	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IMP	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032148	activation of protein kin ase B activity	IC	biological_process
GO:0032435	negative regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IMP	biological_process
GO:0033234	negative regulation of pr otein sumoylation	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IMP	biological_process
GO:0036470	tyrosine 3-monooxygenase activator activity	IDA	molecular_function
GO:0036471	cellular response to glyo xal	IDA	biological_process
GO:0036478	L-dopa decarboxylase acti vator activity	IDA	molecular_function
GO:0042493	response to drug	IEA	biological_process
GO:0042743	hydrogen peroxide metabol ic process	IDA	biological_process
GO:0042743	hydrogen peroxide metabol ic process	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043523	regulation of neuron apop totic process	IDA	biological_process
GO:0043523	regulation of neuron apop totic process	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IDA	biological_process
GO:0044297	cell body	IEA	cellular_component
GO:0044388	small protein activating enzyme binding	IPI	molecular_function
GO:0044390	ubiquitin-like protein co njugating enzyme binding	IPI	molecular_function
GO:0045121	membrane raft	IEA	cellular_component
GO:0045340	mercury ion binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046295	glycolate biosynthetic pr ocess	IDA	biological_process
GO:0046826	negative regulation of pr otein export from nucleus	IGI	biological_process
GO:0050681	androgen receptor binding	IPI	molecular_function
GO:0050727	regulation of inflammator y response	ISS	biological_process
GO:0050787	detoxification of mercury ion	IMP	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	TAS	biological_process
GO:0051444	negative regulation of ub iquitin-protein transfera se activity	IDA	biological_process
GO:0051583	dopamine uptake involved in synaptic transmission	IEA	biological_process
GO:0051881	regulation of mitochondri al membrane potential	IMP	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IC	biological_process
GO:0051899	membrane depolarization	IEA	biological_process
GO:0051920	peroxiredoxin activity	IEA	molecular_function
GO:0060081	membrane hyperpolarizatio n	IEA	biological_process
GO:0060548	negative regulation of ce ll death	IDA	biological_process
GO:0060548	negative regulation of ce ll death	IDA	biological_process
GO:0060765	regulation of androgen re ceptor signaling pathway	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0090073	positive regulation of pr otein homodimerization ac tivity	IDA	biological_process
GO:0097110	scaffold protein binding	IPI	molecular_function
GO:0098793	presynapse	IEA	cellular_component
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	IDA	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	IMP	biological_process
GO:1901215	negative regulation of ne uron death	IDA	biological_process
GO:1901671	positive regulation of su peroxide dismutase activi ty	IDA	biological_process
GO:1901984	negative regulation of pr otein acetylation	IDA	biological_process
GO:1902177	positive regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	IEA	biological_process
GO:1902236	negative regulation of en doplasmic reticulum stres s-induced intrinsic apopt otic signaling pathway	IGI	biological_process
GO:1902903	regulation of supramolecu lar fiber organization	TAS	biological_process
GO:1902958	positive regulation of mi tochondrial electron tran sport, NADH to ubiquinone	IMP	biological_process
GO:1903073	negative regulation of de ath-inducing signaling co mplex assembly	IC	biological_process
GO:1903094	negative regulation of pr otein K48-linked deubiqui tination	IDA	biological_process
GO:1903122	negative regulation of TR AIL-activated apoptotic s ignaling pathway	IMP	biological_process
GO:1903135	cupric ion binding	IDA	molecular_function
GO:1903136	cuprous ion binding	IDA	molecular_function
GO:1903136	cuprous ion binding	IDA	molecular_function
GO:1903168	positive regulation of py rroline-5-carboxylate red uctase activity	IDA	biological_process
GO:1903178	positive regulation of ty rosine 3-monooxygenase ac tivity	IDA	biological_process
GO:1903181	positive regulation of do pamine biosynthetic proce ss	IC	biological_process
GO:1903181	positive regulation of do pamine biosynthetic proce ss	IDA	biological_process
GO:1903190	glyoxal catabolic process	IDA	biological_process
GO:1903197	positive regulation of L- dopa biosynthetic process	IMP	biological_process
GO:1903200	positive regulation of L- dopa decarboxylase activi ty	IDA	biological_process
GO:1903202	negative regulation of ox idative stress-induced ce ll death	IDA	biological_process
GO:1903206	negative regulation of hy drogen peroxide-induced c ell death	IMP	biological_process
GO:1903206	negative regulation of hy drogen peroxide-induced c ell death	IMP	biological_process
GO:1903208	negative regulation of hy drogen peroxide-induced n euron death	IDA	biological_process
GO:1903208	negative regulation of hy drogen peroxide-induced n euron death	IDA	biological_process
GO:1903377	negative regulation of ox idative stress-induced ne uron intrinsic apoptotic signaling pathway	IDA	biological_process
GO:1903384	negative regulation of hy drogen peroxide-induced n euron intrinsic apoptotic signaling pathway	IGI	biological_process
GO:1903428	positive regulation of re active oxygen species bio synthetic process	IEA	biological_process
GO:1903599	positive regulation of mi tophagy	NAS	biological_process
GO:1990381	ubiquitin-specific protea se binding	IPI	molecular_function
GO:1990422	glyoxalase (glycolic acid -forming) activity	IDA	molecular_function
GO:2000157	negative regulation of ub iquitin-specific protease activity	IDA	biological_process
GO:2000277	positive regulation of ox idative phosphorylation u ncoupler activity	IEA	biological_process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IMP	biological_process
GO:2000825	positive regulation of an drogen receptor activity	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001268	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic signaling pathway	IMP	biological_process
GO:0001047	core promoter binding	IC	molecular_function
GO:0003690	double-stranded DNA bindi ng	IDA	molecular_function
GO:0003697	single-stranded DNA bindi ng	IDA	molecular_function
GO:0045560	regulation of TRAIL recep tor biosynthetic process	IMP	biological_process
GO:0005747	mitochondrial respiratory chain complex I	IDA	cellular_component
GO:0000785	chromatin	IDA	cellular_component
GO:0001933	negative regulation of pr otein phosphorylation	IGI	biological_process
GO:0001963	synaptic transmission, do paminergic	IEA	biological_process
GO:0003713	transcription coactivator activity	IGI	molecular_function
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0003723	RNA binding	IEA	molecular_function
GO:0003729	mRNA binding	IDA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IMP	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005758	mitochondrial intermembra ne space	IEA	cellular_component
GO:0005759	mitochondrial matrix	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IMP	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IGI	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006517	protein deglycosylation	IDA	biological_process
GO:0006914	autophagy	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0007005	mitochondrion organizatio n	IEA	biological_process
GO:0007005	mitochondrion organizatio n	ISS	biological_process
GO:0007265	Ras protein signal transd uction	TAS	biological_process
GO:0007338	single fertilization	IEA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008233	peptidase activity	IDA	molecular_function
GO:0008344	adult locomotory behavior	IEA	biological_process
GO:0010273	detoxification of copper ion	IEA	biological_process
GO:0010273	detoxification of copper ion	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	TAS	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016532	superoxide dismutase copp er chaperone activity	IDA	molecular_function
GO:0016605	PML body	IDA	cellular_component
GO:0016684	oxidoreductase activity, acting on peroxide as acc eptor	IDA	molecular_function
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0018323	enzyme active site format ion via L-cysteine sulfin ic acid	IEA	biological_process
GO:0019172	glyoxalase III activity	IEA	molecular_function
GO:0019172	glyoxalase III activity	IDA	molecular_function
GO:0019243	methylglyoxal catabolic p rocess to D-lactate via S -lactoyl-glutathione	IEA	biological_process
GO:0019243	methylglyoxal catabolic p rocess to D-lactate via S -lactoyl-glutathione	IDA	biological_process
GO:0019249	lactate biosynthetic proc ess	IEA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019900	kinase binding	IPI	molecular_function
GO:0019955	cytokine binding	IPI	molecular_function
GO:0030424	axon	IEA	cellular_component
GO:0030424	axon	ISS	cellular_component
GO:0031397	negative regulation of pr otein ubiquitination	IEA	biological_process
GO:0031397	negative regulation of pr otein ubiquitination	IDA	biological_process
GO:0031397	negative regulation of pr otein ubiquitination	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IGI	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IMP	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032148	activation of protein kin ase B activity	IC	biological_process
GO:0032435	negative regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IMP	biological_process
GO:0033234	negative regulation of pr otein sumoylation	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IEA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IMP	biological_process
GO:0034614	cellular response to reac tive oxygen species	IEA	biological_process
GO:0036470	tyrosine 3-monooxygenase activator activity	IDA	molecular_function
GO:0036471	cellular response to glyo xal	IEA	biological_process
GO:0036471	cellular response to glyo xal	IDA	biological_process
GO:0036478	L-dopa decarboxylase acti vator activity	IDA	molecular_function
GO:0042177	negative regulation of pr otein catabolic process	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0042743	hydrogen peroxide metabol ic process	IEA	biological_process
GO:0042743	hydrogen peroxide metabol ic process	IDA	biological_process
GO:0042743	hydrogen peroxide metabol ic process	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043005	neuron projection	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043523	regulation of neuron apop totic process	IDA	biological_process
GO:0043523	regulation of neuron apop totic process	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IDA	biological_process
GO:0044297	cell body	IEA	cellular_component
GO:0044388	small protein activating enzyme binding	IPI	molecular_function
GO:0044390	ubiquitin-like protein co njugating enzyme binding	IPI	molecular_function
GO:0045121	membrane raft	IEA	cellular_component
GO:0045340	mercury ion binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046295	glycolate biosynthetic pr ocess	IEA	biological_process
GO:0046295	glycolate biosynthetic pr ocess	IDA	biological_process
GO:0046826	negative regulation of pr otein export from nucleus	IGI	biological_process
GO:0050681	androgen receptor binding	IPI	molecular_function
GO:0050727	regulation of inflammator y response	IEA	biological_process
GO:0050727	regulation of inflammator y response	ISS	biological_process
GO:0050787	detoxification of mercury ion	IEA	biological_process
GO:0050787	detoxification of mercury ion	IMP	biological_process
GO:0050821	protein stabilization	IEA	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	TAS	biological_process
GO:0051444	negative regulation of ub iquitin-protein transfera se activity	IDA	biological_process
GO:0051583	dopamine uptake involved in synaptic transmission	IEA	biological_process
GO:0051881	regulation of mitochondri al membrane potential	IMP	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IC	biological_process
GO:0051899	membrane depolarization	IEA	biological_process
GO:0051920	peroxiredoxin activity	IEA	molecular_function
GO:0060081	membrane hyperpolarizatio n	IEA	biological_process
GO:0060548	negative regulation of ce ll death	IEA	biological_process
GO:0060548	negative regulation of ce ll death	IDA	biological_process
GO:0060548	negative regulation of ce ll death	IDA	biological_process
GO:0060765	regulation of androgen re ceptor signaling pathway	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070301	cellular response to hydr ogen peroxide	IEA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0090073	positive regulation of pr otein homodimerization ac tivity	IDA	biological_process
GO:0097110	scaffold protein binding	IPI	molecular_function
GO:0098793	presynapse	IEA	cellular_component
GO:0098869	cellular oxidant detoxifi cation	IEA	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	IDA	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	IMP	biological_process
GO:1901215	negative regulation of ne uron death	IDA	biological_process
GO:1901671	positive regulation of su peroxide dismutase activi ty	IDA	biological_process
GO:1901984	negative regulation of pr otein acetylation	IDA	biological_process
GO:1902177	positive regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	IEA	biological_process
GO:1902236	negative regulation of en doplasmic reticulum stres s-induced intrinsic apopt otic signaling pathway	IEA	biological_process
GO:1902236	negative regulation of en doplasmic reticulum stres s-induced intrinsic apopt otic signaling pathway	IGI	biological_process
GO:1902903	regulation of supramolecu lar fiber organization	TAS	biological_process
GO:1902958	positive regulation of mi tochondrial electron tran sport, NADH to ubiquinone	IEA	biological_process
GO:1902958	positive regulation of mi tochondrial electron tran sport, NADH to ubiquinone	IMP	biological_process
GO:1903073	negative regulation of de ath-inducing signaling co mplex assembly	IC	biological_process
GO:1903094	negative regulation of pr otein K48-linked deubiqui tination	IDA	biological_process
GO:1903122	negative regulation of TR AIL-activated apoptotic s ignaling pathway	IMP	biological_process
GO:1903135	cupric ion binding	IDA	molecular_function
GO:1903136	cuprous ion binding	IDA	molecular_function
GO:1903136	cuprous ion binding	IDA	molecular_function
GO:1903168	positive regulation of py rroline-5-carboxylate red uctase activity	IDA	biological_process
GO:1903178	positive regulation of ty rosine 3-monooxygenase ac tivity	IDA	biological_process
GO:1903181	positive regulation of do pamine biosynthetic proce ss	IC	biological_process
GO:1903181	positive regulation of do pamine biosynthetic proce ss	IDA	biological_process
GO:1903190	glyoxal catabolic process	IEA	biological_process
GO:1903190	glyoxal catabolic process	IDA	biological_process
GO:1903197	positive regulation of L- dopa biosynthetic process	IMP	biological_process
GO:1903200	positive regulation of L- dopa decarboxylase activi ty	IDA	biological_process
GO:1903202	negative regulation of ox idative stress-induced ce ll death	IDA	biological_process
GO:1903204	negative regulation of ox idative stress-induced ne uron death	IEA	biological_process
GO:1903206	negative regulation of hy drogen peroxide-induced c ell death	IMP	biological_process
GO:1903206	negative regulation of hy drogen peroxide-induced c ell death	IMP	biological_process
GO:1903208	negative regulation of hy drogen peroxide-induced n euron death	IEA	biological_process
GO:1903208	negative regulation of hy drogen peroxide-induced n euron death	IDA	biological_process
GO:1903208	negative regulation of hy drogen peroxide-induced n euron death	IDA	biological_process
GO:1903377	negative regulation of ox idative stress-induced ne uron intrinsic apoptotic signaling pathway	IDA	biological_process
GO:1903384	negative regulation of hy drogen peroxide-induced n euron intrinsic apoptotic signaling pathway	IEA	biological_process
GO:1903384	negative regulation of hy drogen peroxide-induced n euron intrinsic apoptotic signaling pathway	IGI	biological_process
GO:1903428	positive regulation of re active oxygen species bio synthetic process	IEA	biological_process
GO:1903599	positive regulation of mi tophagy	NAS	biological_process
GO:1990381	ubiquitin-specific protea se binding	IPI	molecular_function
GO:1990422	glyoxalase (glycolic acid -forming) activity	IEA	molecular_function
GO:1990422	glyoxalase (glycolic acid -forming) activity	IDA	molecular_function
GO:2000157	negative regulation of ub iquitin-specific protease activity	IDA	biological_process
GO:2000277	positive regulation of ox idative phosphorylation u ncoupler activity	IEA	biological_process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IMP	biological_process
GO:2000825	positive regulation of an drogen receptor activity	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001268	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic signaling pathway	IMP	biological_process
GO:0001047	core promoter binding	IC	molecular_function
GO:0003690	double-stranded DNA bindi ng	IDA	molecular_function
GO:0003697	single-stranded DNA bindi ng	IDA	molecular_function
GO:0045560	regulation of TRAIL recep tor biosynthetic process	IMP	biological_process
GO:0005747	mitochondrial respiratory chain complex I	IDA	cellular_component
GO:0000785	chromatin	IDA	cellular_component
GO:0001933	negative regulation of pr otein phosphorylation	IGI	biological_process
GO:0003713	transcription coactivator activity	IGI	molecular_function
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0003729	mRNA binding	IDA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005507	copper ion binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005739	mitochondrion	IMP	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	IMP	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IGI	biological_process
GO:0006517	protein deglycosylation	IDA	biological_process
GO:0007005	mitochondrion organizatio n	ISS	biological_process
GO:0007265	Ras protein signal transd uction	TAS	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008233	peptidase activity	IDA	molecular_function
GO:0010273	detoxification of copper ion	IMP	biological_process
GO:0010628	positive regulation of ge ne expression	TAS	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0016532	superoxide dismutase copp er chaperone activity	IDA	molecular_function
GO:0016605	PML body	IDA	cellular_component
GO:0016684	oxidoreductase activity, acting on peroxide as acc eptor	IDA	molecular_function
GO:0019172	glyoxalase III activity	IDA	molecular_function
GO:0019243	methylglyoxal catabolic p rocess to D-lactate via S -lactoyl-glutathione	IDA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019900	kinase binding	IPI	molecular_function
GO:0019955	cytokine binding	IPI	molecular_function
GO:0030424	axon	ISS	cellular_component
GO:0031397	negative regulation of pr otein ubiquitination	IDA	biological_process
GO:0031397	negative regulation of pr otein ubiquitination	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IGI	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032091	negative regulation of pr otein binding	IMP	biological_process
GO:0032091	negative regulation of pr otein binding	IDA	biological_process
GO:0032148	activation of protein kin ase B activity	IC	biological_process
GO:0032435	negative regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IDA	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IMP	biological_process
GO:0033234	negative regulation of pr otein sumoylation	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IDA	biological_process
GO:0034599	cellular response to oxid ative stress	IMP	biological_process
GO:0036470	tyrosine 3-monooxygenase activator activity	IDA	molecular_function
GO:0036471	cellular response to glyo xal	IDA	biological_process
GO:0036478	L-dopa decarboxylase acti vator activity	IDA	molecular_function
GO:0042743	hydrogen peroxide metabol ic process	IDA	biological_process
GO:0042743	hydrogen peroxide metabol ic process	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043523	regulation of neuron apop totic process	IDA	biological_process
GO:0043523	regulation of neuron apop totic process	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IDA	biological_process
GO:0044388	small protein activating enzyme binding	IPI	molecular_function
GO:0044390	ubiquitin-like protein co njugating enzyme binding	IPI	molecular_function
GO:0045340	mercury ion binding	IDA	molecular_function
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046295	glycolate biosynthetic pr ocess	IDA	biological_process
GO:0046826	negative regulation of pr otein export from nucleus	IGI	biological_process
GO:0050681	androgen receptor binding	IPI	molecular_function
GO:0050727	regulation of inflammator y response	ISS	biological_process
GO:0050787	detoxification of mercury ion	IMP	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	TAS	biological_process
GO:0051444	negative regulation of ub iquitin-protein transfera se activity	IDA	biological_process
GO:0051881	regulation of mitochondri al membrane potential	IMP	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IC	biological_process
GO:0060548	negative regulation of ce ll death	IDA	biological_process
GO:0060548	negative regulation of ce ll death	IDA	biological_process
GO:0060765	regulation of androgen re ceptor signaling pathway	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0090073	positive regulation of pr otein homodimerization ac tivity	IDA	biological_process
GO:0097110	scaffold protein binding	IPI	molecular_function
GO:1900182	positive regulation of pr otein localization to nuc leus	IDA	biological_process
GO:1900182	positive regulation of pr otein localization to nuc leus	IMP	biological_process
GO:1901215	negative regulation of ne uron death	IDA	biological_process
GO:1901671	positive regulation of su peroxide dismutase activi ty	IDA	biological_process
GO:1901984	negative regulation of pr otein acetylation	IDA	biological_process
GO:1902236	negative regulation of en doplasmic reticulum stres s-induced intrinsic apopt otic signaling pathway	IGI	biological_process
GO:1902903	regulation of supramolecu lar fiber organization	TAS	biological_process
GO:1902958	positive regulation of mi tochondrial electron tran sport, NADH to ubiquinone	IMP	biological_process
GO:1903073	negative regulation of de ath-inducing signaling co mplex assembly	IC	biological_process
GO:1903094	negative regulation of pr otein K48-linked deubiqui tination	IDA	biological_process
GO:1903122	negative regulation of TR AIL-activated apoptotic s ignaling pathway	IMP	biological_process
GO:1903135	cupric ion binding	IDA	molecular_function
GO:1903136	cuprous ion binding	IDA	molecular_function
GO:1903136	cuprous ion binding	IDA	molecular_function
GO:1903168	positive regulation of py rroline-5-carboxylate red uctase activity	IDA	biological_process
GO:1903178	positive regulation of ty rosine 3-monooxygenase ac tivity	IDA	biological_process
GO:1903181	positive regulation of do pamine biosynthetic proce ss	IC	biological_process
GO:1903181	positive regulation of do pamine biosynthetic proce ss	IDA	biological_process
GO:1903190	glyoxal catabolic process	IDA	biological_process
GO:1903197	positive regulation of L- dopa biosynthetic process	IMP	biological_process
GO:1903200	positive regulation of L- dopa decarboxylase activi ty	IDA	biological_process
GO:1903202	negative regulation of ox idative stress-induced ce ll death	IDA	biological_process
GO:1903206	negative regulation of hy drogen peroxide-induced c ell death	IMP	biological_process
GO:1903206	negative regulation of hy drogen peroxide-induced c ell death	IMP	biological_process
GO:1903208	negative regulation of hy drogen peroxide-induced n euron death	IDA	biological_process
GO:1903208	negative regulation of hy drogen peroxide-induced n euron death	IDA	biological_process
GO:1903377	negative regulation of ox idative stress-induced ne uron intrinsic apoptotic signaling pathway	IDA	biological_process
GO:1903384	negative regulation of hy drogen peroxide-induced n euron intrinsic apoptotic signaling pathway	IGI	biological_process
GO:1903599	positive regulation of mi tophagy	NAS	biological_process
GO:1990381	ubiquitin-specific protea se binding	IPI	molecular_function
GO:1990422	glyoxalase (glycolic acid -forming) activity	IDA	molecular_function
GO:2000157	negative regulation of ub iquitin-specific protease activity	IDA	biological_process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IMP	biological_process
GO:2000825	positive regulation of an drogen receptor activity	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:2001268	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic signaling pathway	IMP	biological_process
GO:0001047	core promoter binding	IC	molecular_function
GO:0003690	double-stranded DNA bindi ng	IDA	molecular_function
GO:0003697	single-stranded DNA bindi ng	IDA	molecular_function
GO:0045560	regulation of TRAIL recep tor biosynthetic process	IMP	biological_process
GO:0005747	mitochondrial respiratory chain complex I	IDA	cellular_component

KEGG pathways

hsa05012 Parkinson's disease

Diseases

Associated diseases	References
Asthenozoospermia	PMID: 21575935
Asthenozoospermia	PMID: 24920663
Celiac disease	PMID: 20190752
Dementia	PMID: 15542239
Endometriosis	PMID: 25721338
Endometriosis	INFBASE25721338
Parkinson's disease	KEGG: H00057, KEGG: H01600
Ulcerative colitis	PMID: 21297633

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25721338	Endometrio sis			95 (17 healthy non-menopausal women, 48 patie nts with ovaria n endometriotic cysts, 30 with adenomyosis or normal endomet ria)		DJ- p-mTOR	Show abstract
21445310	Endometrio sis						Show abstract