Endometriosis Knowledgebase

Search Result

Gene id

1191

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CLU Gene UCSC Ensembl

Aliases

AAG4, APO-J, APOJ, CLI, CLU1, CLU2, KUB1, NA1/NA2, SGP-2, SGP2, SP-40, TRPM-2, TRPM2

Gene name

clusterin

Alternate names

clusterin, aging-associated protein 4, apolipoprotein J, complement cytolysis inhibitor, complement lysis inhibitor, complement-associated protein SP-40,40, ku70-binding protein 1, sulfated glycoprotein 2, testosterone-repressed prostate message 2,

Gene location

8p21.1 (27615030: 27596916) Exons: 11 NC_000008.11

Gene summary(Entrez)

The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.[provided by RefSeq, May 2011]

OMIM

185430

Protein Summary

Protein general information

P10909

Name: Clusterin (Aging-associated gene 4 protein) (Apolipoprotein J) (Apo-J) (Complement cytolysis inhibitor) (CLI) (Complement-associated protein SP-40,40) (Ku70-binding protein 1) (NA1/NA2) (Testosterone-repressed prostate message 2) (TRPM-2) [Cleaved into: C

Length: 449 Mass: 52,495

Tissue specificity: Detected in blood plasma, cerebrospinal fluid, milk, seminal plasma and colon mucosa. Detected in the germinal center of colon lymphoid nodules and in colon parasympathetic ganglia of the Auerbach plexus (at protein level). Ubiquitous.

Sequence

MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLE
EAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPF
YFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRI
VRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKD
QCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANL
TQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Structural information

Motifs	Nuclear localization(78-81) Nuclear localization(443-447)
Interpro:	IPR016016 IPR000753 IPR016015 IPR033986 IPR016014
Prosite:	PS00492 PS00493
Pfam:	PF01093
DIP:	37546
MINT:
STRING:	ENSP00000315130;

Other Databases

GeneCards: CLU; Malacards: CLU

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000902	cell morphogenesis	IDA	biological_process
GO:0001774	microglial cell activatio n	IDA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	IC	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005794	Golgi apparatus	ISS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006629	lipid metabolic process	NAS	biological_process
GO:0006956	complement activation	TAS	biological_process
GO:0006958	complement activation, cl assical pathway	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0009416	response to light stimulu s	IEA	biological_process
GO:0009611	response to wounding	IEA	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016235	aggresome	IEA	cellular_component
GO:0017038	protein import	IDA	biological_process
GO:0030426	growth cone	IEA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031018	endocrine pancreas develo pment	IEA	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031625	ubiquitin protein ligase binding	IDA	molecular_function
GO:0031966	mitochondrial membrane	IEA	cellular_component
GO:0032286	central nervous system my elin maintenance	IMP	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IMP	biological_process
GO:0032463	negative regulation of pr otein homooligomerization	IMP	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IDA	biological_process
GO:0034366	spherical high-density li poprotein particle	IDA	cellular_component
GO:0035864	response to potassium ion	IEA	biological_process
GO:0042583	chromaffin granule	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043691	reverse cholesterol trans port	TAS	biological_process
GO:0044849	estrous cycle	IEA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045597	positive regulation of ce ll differentiation	IEA	biological_process
GO:0047485	protein N-terminus bindin g	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048812	neuron projection morphog enesis	IEA	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0051087	chaperone binding	ISS	molecular_function
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IMP	biological_process
GO:0051131	chaperone-mediated protei n complex assembly	IDA	biological_process
GO:0051787	misfolded protein binding	IDA	molecular_function
GO:0051787	misfolded protein binding	IPI	molecular_function
GO:0051788	response to misfolded pro tein	IDA	biological_process
GO:0061077	chaperone-mediated protei n folding	IDA	biological_process
GO:0061518	microglial cell prolifera tion	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:0097193	intrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0097418	neurofibrillary tangle	IDA	cellular_component
GO:0097418	neurofibrillary tangle	IDA	cellular_component
GO:0097440	apical dendrite	IDA	cellular_component
GO:1900221	regulation of beta-amyloi d clearance	IDA	biological_process
GO:1901214	regulation of neuron deat h	IDA	biological_process
GO:1901214	regulation of neuron deat h	IMP	biological_process
GO:1901216	positive regulation of ne uron death	IDA	biological_process
GO:1901216	positive regulation of ne uron death	IMP	biological_process
GO:1902004	positive regulation of be ta-amyloid formation	ISS	biological_process
GO:1902230	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage	IMP	biological_process
GO:1902430	negative regulation of be ta-amyloid formation	IDA	biological_process
GO:1902430	negative regulation of be ta-amyloid formation	IDA	biological_process
GO:1902847	regulation of neuronal si gnal transduction	IMP	biological_process
GO:1902949	positive regulation of ta u-protein kinase activity	IMP	biological_process
GO:1902998	positive regulation of ne urofibrillary tangle asse mbly	IMP	biological_process
GO:2000060	positive regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IMP	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0016887	ATPase activity	IDA	molecular_function
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0000902	cell morphogenesis	IDA	biological_process
GO:0001774	microglial cell activatio n	IDA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	IC	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005794	Golgi apparatus	ISS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006629	lipid metabolic process	NAS	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006956	complement activation	TAS	biological_process
GO:0006958	complement activation, cl assical pathway	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008219	cell death	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0009416	response to light stimulu s	IEA	biological_process
GO:0009611	response to wounding	IEA	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016235	aggresome	IEA	cellular_component
GO:0017038	protein import	IDA	biological_process
GO:0030426	growth cone	IEA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031018	endocrine pancreas develo pment	IEA	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IDA	molecular_function
GO:0031966	mitochondrial membrane	IEA	cellular_component
GO:0032286	central nervous system my elin maintenance	IMP	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IMP	biological_process
GO:0032463	negative regulation of pr otein homooligomerization	IMP	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IDA	biological_process
GO:0034366	spherical high-density li poprotein particle	IDA	cellular_component
GO:0035864	response to potassium ion	IEA	biological_process
GO:0042583	chromaffin granule	IEA	cellular_component
GO:0043005	neuron projection	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043234	protein complex	IDA	cellular_component
GO:0043691	reverse cholesterol trans port	TAS	biological_process
GO:0044849	estrous cycle	IEA	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045597	positive regulation of ce ll differentiation	IEA	biological_process
GO:0047485	protein N-terminus bindin g	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048812	neuron projection morphog enesis	IEA	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0051087	chaperone binding	ISS	molecular_function
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IMP	biological_process
GO:0051131	chaperone-mediated protei n complex assembly	IDA	biological_process
GO:0051787	misfolded protein binding	IDA	molecular_function
GO:0051787	misfolded protein binding	IPI	molecular_function
GO:0051788	response to misfolded pro tein	IDA	biological_process
GO:0061077	chaperone-mediated protei n folding	IDA	biological_process
GO:0061518	microglial cell prolifera tion	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071363	cellular response to grow th factor stimulus	IEA	biological_process
GO:0072562	blood microparticle	IDA	cellular_component
GO:0097193	intrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0097418	neurofibrillary tangle	IDA	cellular_component
GO:0097418	neurofibrillary tangle	IDA	cellular_component
GO:0097440	apical dendrite	IDA	cellular_component
GO:1900221	regulation of beta-amyloi d clearance	IDA	biological_process
GO:1901214	regulation of neuron deat h	IDA	biological_process
GO:1901214	regulation of neuron deat h	IMP	biological_process
GO:1901216	positive regulation of ne uron death	IEA	biological_process
GO:1901216	positive regulation of ne uron death	IDA	biological_process
GO:1901216	positive regulation of ne uron death	IMP	biological_process
GO:1902004	positive regulation of be ta-amyloid formation	IEA	biological_process
GO:1902004	positive regulation of be ta-amyloid formation	ISS	biological_process
GO:1902230	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage	IMP	biological_process
GO:1902430	negative regulation of be ta-amyloid formation	IDA	biological_process
GO:1902430	negative regulation of be ta-amyloid formation	IDA	biological_process
GO:1902847	regulation of neuronal si gnal transduction	IMP	biological_process
GO:1902949	positive regulation of ta u-protein kinase activity	IMP	biological_process
GO:1902998	positive regulation of ne urofibrillary tangle asse mbly	IMP	biological_process
GO:2000060	positive regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IMP	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0016887	ATPase activity	IDA	molecular_function
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0000902	cell morphogenesis	IDA	biological_process
GO:0001774	microglial cell activatio n	IDA	biological_process
GO:0001836	release of cytochrome c f rom mitochondria	IC	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IDA	cellular_component
GO:0005794	Golgi apparatus	ISS	cellular_component
GO:0006629	lipid metabolic process	NAS	biological_process
GO:0006956	complement activation	TAS	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0017038	protein import	IDA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031625	ubiquitin protein ligase binding	IDA	molecular_function
GO:0032286	central nervous system my elin maintenance	IMP	biological_process
GO:0032436	positive regulation of pr oteasomal ubiquitin-depen dent protein catabolic pr ocess	IMP	biological_process
GO:0032463	negative regulation of pr otein homooligomerization	IMP	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IDA	biological_process
GO:0034366	spherical high-density li poprotein particle	IDA	cellular_component
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043691	reverse cholesterol trans port	TAS	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0050821	protein stabilization	IDA	biological_process
GO:0051087	chaperone binding	ISS	molecular_function
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IMP	biological_process
GO:0051131	chaperone-mediated protei n complex assembly	IDA	biological_process
GO:0051787	misfolded protein binding	IDA	molecular_function
GO:0051787	misfolded protein binding	IPI	molecular_function
GO:0051788	response to misfolded pro tein	IDA	biological_process
GO:0061077	chaperone-mediated protei n folding	IDA	biological_process
GO:0061518	microglial cell prolifera tion	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0072562	blood microparticle	IDA	cellular_component
GO:0097193	intrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0097418	neurofibrillary tangle	IDA	cellular_component
GO:0097418	neurofibrillary tangle	IDA	cellular_component
GO:0097440	apical dendrite	IDA	cellular_component
GO:1900221	regulation of beta-amyloi d clearance	IDA	biological_process
GO:1901214	regulation of neuron deat h	IDA	biological_process
GO:1901214	regulation of neuron deat h	IMP	biological_process
GO:1901216	positive regulation of ne uron death	IDA	biological_process
GO:1901216	positive regulation of ne uron death	IMP	biological_process
GO:1902004	positive regulation of be ta-amyloid formation	ISS	biological_process
GO:1902230	negative regulation of in trinsic apoptotic signali ng pathway in response to DNA damage	IMP	biological_process
GO:1902430	negative regulation of be ta-amyloid formation	IDA	biological_process
GO:1902430	negative regulation of be ta-amyloid formation	IDA	biological_process
GO:1902847	regulation of neuronal si gnal transduction	IMP	biological_process
GO:1902949	positive regulation of ta u-protein kinase activity	IMP	biological_process
GO:1902998	positive regulation of ne urofibrillary tangle asse mbly	IMP	biological_process
GO:2000060	positive regulation of pr otein ubiquitination invo lved in ubiquitin-depende nt protein catabolic proc ess	IMP	biological_process
GO:2001244	positive regulation of in trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0016887	ATPase activity	IDA	molecular_function
GO:0031012	extracellular matrix	IDA	cellular_component

KEGG pathways

hsa04610 Complement and coagulation cascades

Diseases

Associated diseases	References
Endometriosis associated infertility	INFBASE19263878
Endometriosis	INFBASE19263878

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19263878	Endometrio sis			52 (26 fertile women, 26 infer tile ones)	Female infertility	TF C3serum amyloid P-component alpha-1-antitrypsin and clusterin	Show abstract