Endometriosis Knowledgebase

Search Result

Gene id

1230

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CCR1 Gene UCSC Ensembl

Aliases

CD191, CKR-1, CKR1, CMKBR1, HM145, MIP1aR, SCYAR1

Gene name

C-C motif chemokine receptor 1

Alternate names

C-C chemokine receptor type 1, C-C CKR-1, CC-CKR-1, CCR-1, LD78 receptor, MIP-1alpha-R, RANTES receptor, RANTES-R, chemokine (C-C motif) receptor 1, macrophage inflammatory protein 1-alpha receptor,

Gene location

3p21.31 (46208340: 46201708) Exons: 2 NC_000003.12

Gene summary(Entrez)

This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The ligands of this receptor include macrophage inflammatory protein 1 alpha (MIP-1 alpha), regulated on activation normal T expressed and secreted protein (RANTES), monocyte chemoattractant protein 3 (MCP-3), and myeloid progenitor inhibitory factor-1 (MPIF-1). Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. Knockout studies of the mouse homolog suggested the roles of this gene in host protection from inflammatory response, and susceptibility to virus and parasite. This gene and other chemokine receptor genes, including CCR2, CCRL2, CCR3, CCR5 and CCXCR1, are found to form a gene cluster on chromosome 3p. [provided by RefSeq, Jul 2008]

OMIM

601159

Protein Summary

Protein general information

P32246

Name: C C chemokine receptor type 1 (C C CKR 1) (CC CKR 1) (CCR 1) (CCR1) (HM145) (LD78 receptor) (Macrophage inflammatory protein 1 alpha receptor) (MIP 1alpha R) (RANTES R) (CD antigen CD191)

Length: 355 Mass: 41,173

Tissue specificity: Widely expressed in different hematopoietic cells.

Sequence

METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTSIYLLN
LAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILLTIDRYLAIVHAVFALRARTVTFG
VITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKI
LLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF

Structural information

Interpro:	IPR002236 IPR034321 IPR000355 IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001
PDB:	1Y5D
PDBsum:	1Y5D
DIP:	5832
MINT:	140567
STRING:	ENSP00000296140;

Other Databases

GeneCards: CCR1; Malacards: CCR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0004435	phosphatidylinositol phos pholipase C activity	IDA	molecular_function
GO:0004950	chemokine receptor activi ty	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IMP	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006816	calcium ion transport	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006887	exocytosis	IDA	biological_process
GO:0006935	chemotaxis	NAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	IDA	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IDA	biological_process
GO:0007267	cell-cell signaling	IDA	biological_process
GO:0009611	response to wounding	TAS	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0016493	C-C chemokine receptor ac tivity	IDA	molecular_function
GO:0019221	cytokine-mediated signali ng pathway	NAS	biological_process
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030502	negative regulation of bo ne mineralization	IMP	biological_process
GO:0035717	chemokine (C-C motif) lig and 7 binding	IPI	molecular_function
GO:0035717	chemokine (C-C motif) lig and 7 binding	IPI	molecular_function
GO:0045672	positive regulation of os teoclast differentiation	IMP	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0004435	phosphatidylinositol phos pholipase C activity	IDA	molecular_function
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004950	chemokine receptor activi ty	IEA	molecular_function
GO:0004950	chemokine receptor activi ty	IDA	molecular_function
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IMP	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006816	calcium ion transport	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006887	exocytosis	IDA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	NAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	IDA	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IDA	biological_process
GO:0007267	cell-cell signaling	IDA	biological_process
GO:0009611	response to wounding	TAS	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016493	C-C chemokine receptor ac tivity	IEA	molecular_function
GO:0016493	C-C chemokine receptor ac tivity	IDA	molecular_function
GO:0019221	cytokine-mediated signali ng pathway	NAS	biological_process
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030502	negative regulation of bo ne mineralization	IMP	biological_process
GO:0035717	chemokine (C-C motif) lig and 7 binding	IPI	molecular_function
GO:0035717	chemokine (C-C motif) lig and 7 binding	IPI	molecular_function
GO:0045672	positive regulation of os teoclast differentiation	IMP	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0090026	positive regulation of mo nocyte chemotaxis	IEA	biological_process
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0004435	phosphatidylinositol phos pholipase C activity	IDA	molecular_function
GO:0004950	chemokine receptor activi ty	IDA	molecular_function
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IMP	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006816	calcium ion transport	IDA	biological_process
GO:0006874	cellular calcium ion home ostasis	IDA	biological_process
GO:0006887	exocytosis	IDA	biological_process
GO:0006935	chemotaxis	NAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IDA	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007187	G-protein coupled recepto r signaling pathway, coup led to cyclic nucleotide second messenger	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IDA	biological_process
GO:0007267	cell-cell signaling	IDA	biological_process
GO:0009611	response to wounding	TAS	biological_process
GO:0009897	external side of plasma m embrane	IDA	cellular_component
GO:0010629	negative regulation of ge ne expression	IMP	biological_process
GO:0016493	C-C chemokine receptor ac tivity	IDA	molecular_function
GO:0019221	cytokine-mediated signali ng pathway	NAS	biological_process
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0019957	C-C chemokine binding	IPI	molecular_function
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0030502	negative regulation of bo ne mineralization	IMP	biological_process
GO:0035717	chemokine (C-C motif) lig and 7 binding	IPI	molecular_function
GO:0035717	chemokine (C-C motif) lig and 7 binding	IPI	molecular_function
GO:0045672	positive regulation of os teoclast differentiation	IMP	biological_process
GO:0051928	positive regulation of ca lcium ion transport	IDA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IMP	biological_process
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0071791	chemokine (C-C motif) lig and 5 binding	IPI	molecular_function
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04062  Chemokine signaling pathway

Diseases

Associated diseases	References
Allergic rhinitis	KEGG: H01360
Diabetes	PMID: 16249462
Endometriosis	PMID: 19050323
Multiple sclerosis	PMID: 16182378
Female infertility	INFBASE11160842
Endometriosis	INFBASE11160842

PubMed references

PMID	Condition	Infertility_type	Associated_genes	Abstract
19050323	Endometrio sis		CCR1 MCP-1 CA125	Show abstract
17261287	Endometrio sis		CCR1	Show abstract
15950672	Endometrio sis		CCR1	Show abstract
23219091	Endometrio sis		RANTES CCR1	Show abstract
11160842	Endometrio sis	Female infertility	RANTES receptors CCR-1 and CCR-5	Show abstract