Endometriosis Knowledgebase

Search Result

Gene id

1236

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CCR7 Gene UCSC Ensembl

Aliases

BLR2, CC-CKR-7, CCR-7, CD197, CDw197, CMKBR7, EBI1

Gene name

C-C motif chemokine receptor 7

Alternate names

C-C chemokine receptor type 7, Bukitt's lymphoma receptor 2, CC chemokine receptor 7, EBV-induced G protein-coupled receptor 1, Epstein-Barr virus induced gene 1, Epstein-Barr virus-induced G-protein coupled receptor 1, MIP-3 beta receptor, chemokine (C-C motif) receptor 7, lymphocyte-specific G protein-coupled peptide receptor,

Gene location

17q21.2 (40565483: 40553768) Exons: 5 NC_000017.11

Gene summary(Entrez)

The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014]

OMIM

600242

Protein Summary

Protein general information

P32248

Name: C-C chemokine receptor type 7 (C-C CKR-7) (CC-CKR-7) (CCR-7) (BLR2) (CDw197) (Epstein-Barr virus-induced G-protein coupled receptor 1) (EBI1) (EBV-induced G-protein coupled receptor 1) (MIP-3 beta receptor) (CD antigen CD197)

Length: 378 Mass: 42,874

Tissue specificity: Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.

Sequence

MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLG
NGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCI
SIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQV
AQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL
SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTT
FSP

Structural information

Interpro:	IPR001718 IPR000355 IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001
DIP:	5855
MINT:
STRING:	ENSP00000246657;

Other Databases

GeneCards: CCR7; Malacards: CCR7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001768	establishment of T cell p olarity	IC	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IC	biological_process
GO:0002407	dendritic cell chemotaxis	IC	biological_process
GO:0002408	myeloid dendritic cell ch emotaxis	IDA	biological_process
GO:0002408	myeloid dendritic cell ch emotaxis	IC	biological_process
GO:0002606	positive regulation of de ndritic cell antigen proc essing and presentation	ISS	biological_process
GO:0002885	positive regulation of hy persensitivity	ISS	biological_process
GO:0002922	positive regulation of hu moral immune response	ISS	biological_process
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006954	inflammatory response	NAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016493	C-C chemokine receptor ac tivity	ISS	molecular_function
GO:0030838	positive regulation of ac tin filament polymerizati on	IC	biological_process
GO:0031274	positive regulation of ps eudopodium assembly	IC	biological_process
GO:0031529	ruffle organization	IC	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032649	regulation of interferon- gamma production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0034695	response to prostaglandin E	IC	biological_process
GO:0035757	chemokine (C-C motif) lig and 19 binding	IPI	molecular_function
GO:0035758	chemokine (C-C motif) lig and 21 binding	IPI	molecular_function
GO:0038115	chemokine (C-C motif) lig and 19 signaling pathway	IEA	biological_process
GO:0038116	chemokine (C-C motif) lig and 21 signaling pathway	IEA	biological_process
GO:0038117	C-C motif chemokine 19 re ceptor activity	IDA	molecular_function
GO:0038121	C-C motif chemokine 21 re ceptor activity	IDA	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IC	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IC	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IC	biological_process
GO:0045060	negative thymic T cell se lection	IEA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IC	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IC	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IC	biological_process
GO:0046330	positive regulation of JN K cascade	IC	biological_process
GO:0048872	homeostasis of number of cells	IEA	biological_process
GO:0050706	regulation of interleukin -1 beta secretion	ISS	biological_process
GO:0050862	positive regulation of T cell receptor signaling p athway	IEA	biological_process
GO:0051209	release of sequestered ca lcium ion into cytosol	IC	biological_process
GO:0051491	positive regulation of fi lopodium assembly	IC	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IC	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IC	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IC	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IC	biological_process
GO:0071345	cellular response to cyto kine stimulus	IDA	biological_process
GO:0071731	response to nitric oxide	IC	biological_process
GO:0072610	interleukin-12 secretion	ISS	biological_process
GO:0090023	positive regulation of ne utrophil chemotaxis	IDA	biological_process
GO:0090630	activation of GTPase acti vity	IC	biological_process
GO:0097022	lymphocyte migration into lymph node	TAS	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	ISS	biological_process
GO:2000107	negative regulation of le ukocyte apoptotic process	IC	biological_process
GO:2000147	positive regulation of ce ll motility	IC	biological_process
GO:2000510	positive regulation of de ndritic cell chemotaxis	ISS	biological_process
GO:2000522	positive regulation of im munological synapse forma tion	ISS	biological_process
GO:2000525	positive regulation of T cell costimulation	ISS	biological_process
GO:2000526	positive regulation of gl ycoprotein biosynthetic p rocess involved in immuno logical synapse formation	ISS	biological_process
GO:2000547	regulation of dendritic c ell dendrite assembly	ISS	biological_process
GO:0001768	establishment of T cell p olarity	IC	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IC	biological_process
GO:0002407	dendritic cell chemotaxis	IC	biological_process
GO:0002408	myeloid dendritic cell ch emotaxis	IDA	biological_process
GO:0002408	myeloid dendritic cell ch emotaxis	IC	biological_process
GO:0002606	positive regulation of de ndritic cell antigen proc essing and presentation	IEA	biological_process
GO:0002606	positive regulation of de ndritic cell antigen proc essing and presentation	ISS	biological_process
GO:0002885	positive regulation of hy persensitivity	IEA	biological_process
GO:0002885	positive regulation of hy persensitivity	ISS	biological_process
GO:0002922	positive regulation of hu moral immune response	IEA	biological_process
GO:0002922	positive regulation of hu moral immune response	ISS	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004950	chemokine receptor activi ty	IEA	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005622	intracellular	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	NAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016493	C-C chemokine receptor ac tivity	IEA	molecular_function
GO:0016493	C-C chemokine receptor ac tivity	IEA	molecular_function
GO:0016493	C-C chemokine receptor ac tivity	ISS	molecular_function
GO:0030838	positive regulation of ac tin filament polymerizati on	IC	biological_process
GO:0031274	positive regulation of ps eudopodium assembly	IC	biological_process
GO:0031529	ruffle organization	IC	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032649	regulation of interferon- gamma production	IEA	biological_process
GO:0032649	regulation of interferon- gamma production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IEA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0034695	response to prostaglandin E	IC	biological_process
GO:0035757	chemokine (C-C motif) lig and 19 binding	IPI	molecular_function
GO:0035758	chemokine (C-C motif) lig and 21 binding	IPI	molecular_function
GO:0038115	chemokine (C-C motif) lig and 19 signaling pathway	IEA	biological_process
GO:0038116	chemokine (C-C motif) lig and 21 signaling pathway	IEA	biological_process
GO:0038117	C-C motif chemokine 19 re ceptor activity	IDA	molecular_function
GO:0038121	C-C motif chemokine 21 re ceptor activity	IDA	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IC	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IC	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IC	biological_process
GO:0045060	negative thymic T cell se lection	IEA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IC	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IC	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IC	biological_process
GO:0046330	positive regulation of JN K cascade	IC	biological_process
GO:0048872	homeostasis of number of cells	IEA	biological_process
GO:0050706	regulation of interleukin -1 beta secretion	IEA	biological_process
GO:0050706	regulation of interleukin -1 beta secretion	ISS	biological_process
GO:0050862	positive regulation of T cell receptor signaling p athway	IEA	biological_process
GO:0051209	release of sequestered ca lcium ion into cytosol	IC	biological_process
GO:0051491	positive regulation of fi lopodium assembly	IC	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IC	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IC	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IC	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IC	biological_process
GO:0071345	cellular response to cyto kine stimulus	IDA	biological_process
GO:0071731	response to nitric oxide	IC	biological_process
GO:0072610	interleukin-12 secretion	IEA	biological_process
GO:0072610	interleukin-12 secretion	ISS	biological_process
GO:0090023	positive regulation of ne utrophil chemotaxis	IEA	biological_process
GO:0090023	positive regulation of ne utrophil chemotaxis	IDA	biological_process
GO:0090630	activation of GTPase acti vity	IC	biological_process
GO:0097022	lymphocyte migration into lymph node	TAS	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	IEA	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	ISS	biological_process
GO:2000107	negative regulation of le ukocyte apoptotic process	IC	biological_process
GO:2000147	positive regulation of ce ll motility	IC	biological_process
GO:2000510	positive regulation of de ndritic cell chemotaxis	IEA	biological_process
GO:2000510	positive regulation of de ndritic cell chemotaxis	ISS	biological_process
GO:2000522	positive regulation of im munological synapse forma tion	IEA	biological_process
GO:2000522	positive regulation of im munological synapse forma tion	ISS	biological_process
GO:2000525	positive regulation of T cell costimulation	IEA	biological_process
GO:2000525	positive regulation of T cell costimulation	ISS	biological_process
GO:2000526	positive regulation of gl ycoprotein biosynthetic p rocess involved in immuno logical synapse formation	IEA	biological_process
GO:2000526	positive regulation of gl ycoprotein biosynthetic p rocess involved in immuno logical synapse formation	ISS	biological_process
GO:2000547	regulation of dendritic c ell dendrite assembly	ISS	biological_process
GO:0001768	establishment of T cell p olarity	IC	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IC	biological_process
GO:0002407	dendritic cell chemotaxis	IC	biological_process
GO:0002408	myeloid dendritic cell ch emotaxis	IDA	biological_process
GO:0002408	myeloid dendritic cell ch emotaxis	IC	biological_process
GO:0002606	positive regulation of de ndritic cell antigen proc essing and presentation	ISS	biological_process
GO:0002885	positive regulation of hy persensitivity	ISS	biological_process
GO:0002922	positive regulation of hu moral immune response	ISS	biological_process
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006954	inflammatory response	NAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016493	C-C chemokine receptor ac tivity	ISS	molecular_function
GO:0030838	positive regulation of ac tin filament polymerizati on	IC	biological_process
GO:0031274	positive regulation of ps eudopodium assembly	IC	biological_process
GO:0031529	ruffle organization	IC	biological_process
GO:0032649	regulation of interferon- gamma production	ISS	biological_process
GO:0032735	positive regulation of in terleukin-12 production	ISS	biological_process
GO:0034695	response to prostaglandin E	IC	biological_process
GO:0035757	chemokine (C-C motif) lig and 19 binding	IPI	molecular_function
GO:0035758	chemokine (C-C motif) lig and 21 binding	IPI	molecular_function
GO:0038117	C-C motif chemokine 19 re ceptor activity	IDA	molecular_function
GO:0038121	C-C motif chemokine 21 re ceptor activity	IDA	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IC	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IC	biological_process
GO:0043552	positive regulation of ph osphatidylinositol 3-kina se activity	IC	biological_process
GO:0045785	positive regulation of ce ll adhesion	IC	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IC	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IC	biological_process
GO:0046330	positive regulation of JN K cascade	IC	biological_process
GO:0050706	regulation of interleukin -1 beta secretion	ISS	biological_process
GO:0051209	release of sequestered ca lcium ion into cytosol	IC	biological_process
GO:0051491	positive regulation of fi lopodium assembly	IC	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IC	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IC	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IC	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IC	biological_process
GO:0071345	cellular response to cyto kine stimulus	IDA	biological_process
GO:0071731	response to nitric oxide	IC	biological_process
GO:0072610	interleukin-12 secretion	ISS	biological_process
GO:0090023	positive regulation of ne utrophil chemotaxis	IDA	biological_process
GO:0090630	activation of GTPase acti vity	IC	biological_process
GO:0097022	lymphocyte migration into lymph node	TAS	biological_process
GO:0097029	mature conventional dendr itic cell differentiation	ISS	biological_process
GO:2000107	negative regulation of le ukocyte apoptotic process	IC	biological_process
GO:2000147	positive regulation of ce ll motility	IC	biological_process
GO:2000510	positive regulation of de ndritic cell chemotaxis	ISS	biological_process
GO:2000522	positive regulation of im munological synapse forma tion	ISS	biological_process
GO:2000525	positive regulation of T cell costimulation	ISS	biological_process
GO:2000526	positive regulation of gl ycoprotein biosynthetic p rocess involved in immuno logical synapse formation	ISS	biological_process
GO:2000547	regulation of dendritic c ell dendrite assembly	ISS	biological_process

KEGG pathways

hsa04062 Chemokine signaling pathway
hsa04060 Cytokine-cytokine receptor interaction

Diseases

Associated diseases	References
Meningeal cancer	GAD20406964
Lupus erythematosus	GAD17587445
Leukemia	GAD19074885
Diabetes	GAD15918014
Breast cancer	GAD19196101
Endometriosis	PubMed28856757

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28856757	Endometrio sis			70 (38 women wi th endometriosi s, 32 controls)		CCL19 CCR7	Show abstract