Endometriosis Knowledgebase

Search Result

Gene id

1270

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CNTF Gene UCSC Ensembl

Aliases

HCNTF

Gene name

ciliary neurotrophic factor

Alternate names

ciliary neurotrophic factor,

Gene location

11q12.1 (58622672: 58625732) Exons: 2 NC_000011.10

Gene summary(Entrez)

The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010]

OMIM

118945

Protein Summary

Protein general information

P26441

Name: Ciliary neurotrophic factor (CNTF)

Length: 200 Mass: 22,931

Tissue specificity: Nervous system.

Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQE
NLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGG
LFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Structural information

Interpro:	IPR009079 IPR000151
Pfam:	PF01110
PDB:	1CNT
PDBsum:	1CNT
DIP:	5776
MINT:	205057
STRING:	ENSP00000355370;

Other Databases

GeneCards: CNTF; Malacards: CNTF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005127	ciliary neurotrophic fact or receptor binding	TAS	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IC	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0007165	signal transduction	NAS	biological_process
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IBA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0030424	axon	IBA	cellular_component
GO:0040007	growth	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IDA	biological_process
GO:0046533	negative regulation of ph otoreceptor cell differen tiation	IEA	biological_process
GO:0046668	regulation of retinal cel l programmed cell death	IEA	biological_process
GO:0048143	astrocyte activation	IBA	biological_process
GO:0048644	muscle organ morphogenesi s	IEA	biological_process
GO:0048666	neuron development	IEA	biological_process
GO:0048680	positive regulation of ax on regeneration	IBA	biological_process
GO:0070120	ciliary neurotrophic fact or-mediated signaling pat hway	IDA	biological_process
GO:0097058	CRLF-CLCF1 complex	IDA	cellular_component
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005127	ciliary neurotrophic fact or receptor binding	TAS	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IC	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0007165	signal transduction	NAS	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007399	nervous system developmen t	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IBA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030424	axon	IBA	cellular_component
GO:0040007	growth	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IDA	biological_process
GO:0046533	negative regulation of ph otoreceptor cell differen tiation	IEA	biological_process
GO:0046668	regulation of retinal cel l programmed cell death	IEA	biological_process
GO:0048143	astrocyte activation	IBA	biological_process
GO:0048644	muscle organ morphogenesi s	IEA	biological_process
GO:0048666	neuron development	IEA	biological_process
GO:0048680	positive regulation of ax on regeneration	IBA	biological_process
GO:0070120	ciliary neurotrophic fact or-mediated signaling pat hway	IDA	biological_process
GO:0097058	CRLF-CLCF1 complex	IDA	cellular_component
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005127	ciliary neurotrophic fact or receptor binding	TAS	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IC	cellular_component
GO:0007165	signal transduction	NAS	biological_process
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IBA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0030424	axon	IBA	cellular_component
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IDA	biological_process
GO:0048143	astrocyte activation	IBA	biological_process
GO:0048680	positive regulation of ax on regeneration	IBA	biological_process
GO:0070120	ciliary neurotrophic fact or-mediated signaling pat hway	IDA	biological_process
GO:0097058	CRLF-CLCF1 complex	IDA	cellular_component

KEGG pathways

hsa04060 Cytokine-cytokine receptor interaction
hsa04630 Jak-STAT signaling pathway

Diseases

Associated diseases	References
Endometriosis (Pelvic)	PMID: 12890930
Depression	PMID: 16797081
Multiple sclerosis	PMID: 11890844
Obesity	PMID: 9628240
Pelvic endometriosis	PMID: 12890930
Pelvic endometriosis	PMID: 12890930
Psychiatric disorders	PMID: 8834105
Schizophrenia	PMID: 9247976
Pelvic endometriosis	INFBASE12890930

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12890930	Endometrio sis (Pelvi c)			51 (31 women wi th endometriosi s, 20 women wit hout endometrio sis)		CNTF	Show abstract