Endometriosis Knowledgebase

Search Result

Gene id

133

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ADM Gene UCSC Ensembl

Aliases

AM, PAMP

Gene name

adrenomedullin

Alternate names

ADM, preproadrenomedullin, proadrenomedullin N-20 terminal peptide,

Gene location

11p15.4 (10304979: 10307401) Exons: 4 NC_000011.10

Gene summary(Entrez)

The protein encoded by this gene is a preprohormone which is cleaved to form two biologically active peptides, adrenomedullin and proadrenomedullin N-terminal 20 peptide. Adrenomedullin is a 52 aa peptide with several functions, including vasodilation, regulation of hormone secretion, promotion of angiogenesis, and antimicrobial activity. The antimicrobial activity is antibacterial, as the peptide has been shown to kill E. coli and S. aureus at low concentration. [provided by RefSeq, Aug 2014]

OMIM

103275

SNPs

rs1061622

Strand:    Allele origin:   Allele change: G/T   Mutation type: snp

CM000663.2   g.12192898T>G
NC_000001.10   g.12252955T>G
NC_000001.11   g.12192898T>G
NG_029791.1   g.30896T>G
NM_001066.2   c.587T>G
NP_001057.1   p.Met196Arg
XP_011540362.1   p.Met196Arg
XP_011540365.1   p.Met196Arg
XP_016857700.1   p.Met196Arg
XP_016857701.1   p.Met145Arg
XP_016857702.1   p.Met145Arg
XP_016857703.1   p.Met1Arg
XP_016857704.1   p.Met1Arg
XR_244793.1   n.692T>G

Protein Summary

Protein general information

P35318

Name: ADM [Cleaved into: Adrenomedullin (AM); Proadrenomedullin N 20 terminal peptide (ProAM N terminal 20 peptide) (PAMP) (ProAM N20)]

Length: 185 Mass: 20,420

Tissue specificity: Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung, ventricle and kidney tissues.

Sequence

MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKG
ASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRR
RRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL

Structural information

Interpro:	IPR001710 IPR021116
Pfam:	PF00214
PDB:	2FLY 2L7S 4RWF
PDBsum:	2FLY 2L7S 4RWF
STRING:	ENSP00000278175;

Other Databases

GeneCards: ADM; Malacards: ADM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001570	vasculogenesis	IDA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001843	neural tube closure	IEA	biological_process
GO:0002026	regulation of the force o f heart contraction	IEA	biological_process
GO:0002031	G-protein coupled recepto r internalization	IDA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006171	cAMP biosynthetic process	IDA	biological_process
GO:0006701	progesterone biosynthetic process	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008015	blood circulation	TAS	biological_process
GO:0008209	androgen metabolic proces s	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009409	response to cold	IEA	biological_process
GO:0009611	response to wounding	IEA	biological_process
GO:0010460	positive regulation of he art rate	IEA	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019933	cAMP-mediated signaling	IEA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031102	neuron projection regener ation	IEA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0031700	adrenomedullin receptor b inding	IEA	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0042594	response to starvation	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043116	negative regulation of va scular permeability	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045906	negative regulation of va soconstriction	IDA	biological_process
GO:0045909	positive regulation of va sodilation	IEA	biological_process
GO:0046879	hormone secretion	IEA	biological_process
GO:0048589	developmental growth	IEA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0060670	branching involved in lab yrinthine layer morphogen esis	IEA	biological_process
GO:0060712	spongiotrophoblast layer development	IEA	biological_process
GO:0097084	vascular smooth muscle ce ll development	IEA	biological_process
GO:2001214	positive regulation of va sculogenesis	IEA	biological_process
GO:0001878	response to yeast	IDA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0001570	vasculogenesis	IDA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001843	neural tube closure	IEA	biological_process
GO:0002026	regulation of the force o f heart contraction	IEA	biological_process
GO:0002031	G-protein coupled recepto r internalization	IDA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006171	cAMP biosynthetic process	IDA	biological_process
GO:0006171	cAMP biosynthetic process	TAS	biological_process
GO:0006701	progesterone biosynthetic process	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007565	female pregnancy	TAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008015	blood circulation	TAS	biological_process
GO:0008209	androgen metabolic proces s	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009409	response to cold	IEA	biological_process
GO:0009611	response to wounding	IEA	biological_process
GO:0009611	response to wounding	TAS	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010460	positive regulation of he art rate	IEA	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0019933	cAMP-mediated signaling	IEA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031102	neuron projection regener ation	IEA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0031700	adrenomedullin receptor b inding	IEA	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0042594	response to starvation	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043116	negative regulation of va scular permeability	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045906	negative regulation of va soconstriction	IDA	biological_process
GO:0045909	positive regulation of va sodilation	IEA	biological_process
GO:0046879	hormone secretion	IEA	biological_process
GO:0048589	developmental growth	IEA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0055074	calcium ion homeostasis	IEA	biological_process
GO:0060670	branching involved in lab yrinthine layer morphogen esis	IEA	biological_process
GO:0060712	spongiotrophoblast layer development	IEA	biological_process
GO:0097084	vascular smooth muscle ce ll development	IEA	biological_process
GO:2001214	positive regulation of va sculogenesis	IEA	biological_process
GO:0001878	response to yeast	IDA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process
GO:0001570	vasculogenesis	IDA	biological_process
GO:0002031	G-protein coupled recepto r internalization	IDA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006171	cAMP biosynthetic process	IDA	biological_process
GO:0006171	cAMP biosynthetic process	TAS	biological_process
GO:0006701	progesterone biosynthetic process	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007565	female pregnancy	TAS	biological_process
GO:0008015	blood circulation	TAS	biological_process
GO:0009611	response to wounding	TAS	biological_process
GO:0019731	antibacterial humoral res ponse	IDA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IDA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0045906	negative regulation of va soconstriction	IDA	biological_process
GO:0050829	defense response to Gram- negative bacterium	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IDA	biological_process
GO:0001878	response to yeast	IDA	biological_process
GO:0019732	antifungal humoral respon se	IDA	biological_process

Diseases

Associated diseases	References
Asthenozoospermia	PMID: 21990183
Azoospermia	PMID: 16854513
Bipolar disorder	PMID: 20713499
Diabetes	PMID: 12753312
Endometriosis	PMID: 27491770
Hyperandrogenism	PMID: 24224860
Hypertension	PMID: 11463752
Male infertility	PMID: 16854513
Oligozoospermia	PMID: 16854513
Polycystic ovary syndrome (PCOS)	PMID: 21791966
Pregnancy loss	PMID: 20170350
Progressive motility	PMID: 21990183
Spermatogenetic defects	PMID: 15908101
Endometriosis	INFBASE27491770
Unexplained infertility	PMID: 20954838
Varicocele	PMID: 25335788
Zona pellucida-binding capacity of spermatozoa	PMID: 21990183

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27491770	Endometrio sis			340 (200 women with advanced s tage endometrio sis, 140 normal ovulating wome n with tubal fa ctor infertilit y (without endo metriosis))	Female infertility	IL1B TNFA IL2 IL8 IL12 IFNG IL4 IL6 IL10 VEGF ADM angiogenin	Show abstract