Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 133
Gene Summary     SNPs    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol ADM   Gene   UCSC   Ensembl
Aliases AM, PAMP
Gene name adrenomedullin
Alternate names ADM, preproadrenomedullin, proadrenomedullin N-20 terminal peptide,
Gene location 11p15.4 (10304979: 10307401)     Exons: 4     NC_000011.10
Gene summary(Entrez) The protein encoded by this gene is a preprohormone which is cleaved to form two biologically active peptides, adrenomedullin and proadrenomedullin N-terminal 20 peptide. Adrenomedullin is a 52 aa peptide with several functions, including vasodilation, regulation of hormone secretion, promotion of angiogenesis, and antimicrobial activity. The antimicrobial activity is antibacterial, as the peptide has been shown to kill E. coli and S. aureus at low concentration. [provided by RefSeq, Aug 2014]
OMIM 103275

SNPs

rs1061622

Strand:    Allele origin:   Allele change: G/T   Mutation type: snp

CM000663.2   g.12192898T>G
NC_000001.10   g.12252955T>G
NC_000001.11   g.12192898T>G
NG_029791.1   g.30896T>G
NM_001066.2   c.587T>G
NP_001057.1   p.Met196Arg
XP_011540362.1   p.Met196Arg
XP_011540365.1   p.Met196Arg
XP_016857700.1   p.Met196Arg
XP_016857701.1   p.Met145Arg
XP_016857702.1   p.Met145Arg
XP_016857703.1   p.Met1Arg
XP_016857704.1   p.Met1Arg
XR_244793.1   n.692T>G

Protein Summary

Protein general information P35318  

Name: ADM [Cleaved into: Adrenomedullin (AM); Proadrenomedullin N 20 terminal peptide (ProAM N terminal 20 peptide) (PAMP) (ProAM N20)]

Length: 185  Mass: 20,420

Tissue specificity: Highest levels found in pheochromocytoma and adrenal medulla. Also found in lung, ventricle and kidney tissues.

Sequence MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRPQDMKG
ASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGYGRRR
RRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
Structural information
Interpro:  IPR001710 IPR021116

Pfam:  
PF00214

PDB:  
2FLY 2L7S 4RWF
PDBsum:   2FLY 2L7S 4RWF
STRING:   ENSP00000278175;
Other Databases GeneCards:  ADM;  Malacards:  ADM

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001570 vasculogenesis
IDA biological_process
GO:0001666 response to hypoxia
IEA biological_process
GO:0001843 neural tube closure
IEA biological_process
GO:0002026 regulation of the force o
f heart contraction
IEA biological_process
GO:0002031 G-protein coupled recepto
r internalization
IDA biological_process
GO:0005102 receptor binding
TAS molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005179 hormone activity
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0006171 cAMP biosynthetic process
IDA biological_process
GO:0006701 progesterone biosynthetic
process
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IEA biological_process
GO:0007267 cell-cell signaling
TAS biological_process
GO:0007507 heart development
IEA biological_process
GO:0007565 female pregnancy
IEA biological_process
GO:0007568 aging
IEA biological_process
GO:0008015 blood circulation
TAS biological_process
GO:0008209 androgen metabolic proces
s
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IEA biological_process
GO:0008285 negative regulation of ce
ll proliferation
IEA biological_process
GO:0009409 response to cold
IEA biological_process
GO:0009611 response to wounding
IEA biological_process
GO:0010460 positive regulation of he
art rate
IEA biological_process
GO:0019731 antibacterial humoral res
ponse
IDA biological_process
GO:0019933 cAMP-mediated signaling
IEA biological_process
GO:0030819 positive regulation of cA
MP biosynthetic process
IDA biological_process
GO:0031100 animal organ regeneration
IEA biological_process
GO:0031102 neuron projection regener
ation
IEA biological_process
GO:0031623 receptor internalization
IDA biological_process
GO:0031623 receptor internalization
IDA biological_process
GO:0031623 receptor internalization
IDA biological_process
GO:0031700 adrenomedullin receptor b
inding
IEA molecular_function
GO:0032496 response to lipopolysacch
aride
IEA biological_process
GO:0032868 response to insulin
IEA biological_process
GO:0042475 odontogenesis of dentin-c
ontaining tooth
IEA biological_process
GO:0042594 response to starvation
IEA biological_process
GO:0043065 positive regulation of ap
optotic process
IEA biological_process
GO:0043116 negative regulation of va
scular permeability
IEA biological_process
GO:0045766 positive regulation of an
giogenesis
IEA biological_process
GO:0045906 negative regulation of va
soconstriction
IDA biological_process
GO:0045909 positive regulation of va
sodilation
IEA biological_process
GO:0046879 hormone secretion
IEA biological_process
GO:0048589 developmental growth
IEA biological_process
GO:0050829 defense response to Gram-
negative bacterium
IDA biological_process
GO:0050830 defense response to Gram-
positive bacterium
IDA biological_process
GO:0050830 defense response to Gram-
positive bacterium
IDA biological_process
GO:0051384 response to glucocorticoi
d
IEA biological_process
GO:0060670 branching involved in lab
yrinthine layer morphogen
esis
IEA biological_process
GO:0060712 spongiotrophoblast layer
development
IEA biological_process
GO:0097084 vascular smooth muscle ce
ll development
IEA biological_process
GO:2001214 positive regulation of va
sculogenesis
IEA biological_process
GO:0001878 response to yeast
IDA biological_process
GO:0019732 antifungal humoral respon
se
IDA biological_process
GO:0001570 vasculogenesis
IDA biological_process
GO:0001666 response to hypoxia
IEA biological_process
GO:0001843 neural tube closure
IEA biological_process
GO:0002026 regulation of the force o
f heart contraction
IEA biological_process
GO:0002031 G-protein coupled recepto
r internalization
IDA biological_process
GO:0005102 receptor binding
TAS molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005179 hormone activity
IEA molecular_function
GO:0005179 hormone activity
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005829 cytosol
IEA cellular_component
GO:0006171 cAMP biosynthetic process
IDA biological_process
GO:0006171 cAMP biosynthetic process
TAS biological_process
GO:0006701 progesterone biosynthetic
process
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007204 positive regulation of cy
tosolic calcium ion conce
ntration
IEA biological_process
GO:0007267 cell-cell signaling
TAS biological_process
GO:0007507 heart development
IEA biological_process
GO:0007565 female pregnancy
IEA biological_process
GO:0007565 female pregnancy
TAS biological_process
GO:0007568 aging
IEA biological_process
GO:0008015 blood circulation
TAS biological_process
GO:0008209 androgen metabolic proces
s
IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
IEA biological_process
GO:0008285 negative regulation of ce
ll proliferation
IEA biological_process
GO:0009409 response to cold
IEA biological_process
GO:0009611 response to wounding
IEA biological_process
GO:0009611 response to wounding
TAS biological_process
GO:0010033 response to organic subst
ance
IEA biological_process
GO:0010460 positive regulation of he
art rate
IEA biological_process
GO:0019731 antibacterial humoral res
ponse
IDA biological_process
GO:0019933 cAMP-mediated signaling
IEA biological_process
GO:0030819 positive regulation of cA
MP biosynthetic process
IDA biological_process
GO:0031100 animal organ regeneration
IEA biological_process
GO:0031102 neuron projection regener
ation
IEA biological_process
GO:0031623 receptor internalization
IDA biological_process
GO:0031623 receptor internalization
IDA biological_process
GO:0031623 receptor internalization
IDA biological_process
GO:0031700 adrenomedullin receptor b
inding
IEA molecular_function
GO:0032496 response to lipopolysacch
aride
IEA biological_process
GO:0032868 response to insulin
IEA biological_process
GO:0042475 odontogenesis of dentin-c
ontaining tooth
IEA biological_process
GO:0042594 response to starvation
IEA biological_process
GO:0043065 positive regulation of ap
optotic process
IEA biological_process
GO:0043116 negative regulation of va
scular permeability
IEA biological_process
GO:0045766 positive regulation of an
giogenesis
IEA biological_process
GO:0045906 negative regulation of va
soconstriction
IDA biological_process
GO:0045909 positive regulation of va
sodilation
IEA biological_process
GO:0046879 hormone secretion
IEA biological_process
GO:0048589 developmental growth
IEA biological_process
GO:0050829 defense response to Gram-
negative bacterium
IDA biological_process
GO:0050830 defense response to Gram-
positive bacterium
IDA biological_process
GO:0050830 defense response to Gram-
positive bacterium
IDA biological_process
GO:0051384 response to glucocorticoi
d
IEA biological_process
GO:0055074 calcium ion homeostasis
IEA biological_process
GO:0060670 branching involved in lab
yrinthine layer morphogen
esis
IEA biological_process
GO:0060712 spongiotrophoblast layer
development
IEA biological_process
GO:0097084 vascular smooth muscle ce
ll development
IEA biological_process
GO:2001214 positive regulation of va
sculogenesis
IEA biological_process
GO:0001878 response to yeast
IDA biological_process
GO:0019732 antifungal humoral respon
se
IDA biological_process
GO:0001570 vasculogenesis
IDA biological_process
GO:0002031 G-protein coupled recepto
r internalization
IDA biological_process
GO:0005102 receptor binding
TAS molecular_function
GO:0005102 receptor binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005615 extracellular space
IDA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0006171 cAMP biosynthetic process
IDA biological_process
GO:0006171 cAMP biosynthetic process
TAS biological_process
GO:0006701 progesterone biosynthetic
process
TAS biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007267 cell-cell signaling
TAS biological_process
GO:0007565 female pregnancy
TAS biological_process
GO:0008015 blood circulation
TAS biological_process
GO:0009611 response to wounding
TAS biological_process
GO:0019731 antibacterial humoral res
ponse
IDA biological_process
GO:0030819 positive regulation of cA
MP biosynthetic process
IDA biological_process
GO:0031623 receptor internalization
IDA biological_process
GO:0031623 receptor internalization
IDA biological_process
GO:0031623 receptor internalization
IDA biological_process
GO:0045906 negative regulation of va
soconstriction
IDA biological_process
GO:0050829 defense response to Gram-
negative bacterium
IDA biological_process
GO:0050830 defense response to Gram-
positive bacterium
IDA biological_process
GO:0050830 defense response to Gram-
positive bacterium
IDA biological_process
GO:0001878 response to yeast
IDA biological_process
GO:0019732 antifungal humoral respon
se
IDA biological_process

Diseases

Associated diseases References
Asthenozoospermia PMID: 21990183
Azoospermia PMID: 16854513
Bipolar disorder PMID: 20713499
Diabetes PMID: 12753312
Endometriosis PMID: 27491770
Hyperandrogenism PMID: 24224860
Hypertension PMID: 11463752
Male infertility PMID: 16854513
Oligozoospermia PMID: 16854513
Polycystic ovary syndrome (PCOS) PMID: 21791966
Pregnancy loss PMID: 20170350
Progressive motility PMID: 21990183
Spermatogenetic defects PMID: 15908101
Endometriosis INFBASE27491770
Unexplained infertility PMID: 20954838
Varicocele PMID: 25335788
Zona pellucida-binding capacity of spermatozoa PMID: 21990183

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
27491770 Endometrio
sis

340 (200 women
with advanced s
tage endometrio
sis, 140 normal
ovulating wome
n with tubal fa
ctor infertilit
y (without endo
metriosis))
Female infertility IL1B
TNFA
IL2
IL8
IL12
IFNG
IL4
IL6
IL10
VEGF
ADM
angiogenin
Show abstract