Search Result
| Gene id | 1385 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary KEGG pathways Diseases PubMed references | |||||||||||||||||||
Gene Summary |
|||||||||||||||||||
| Gene Symbol | CREB1 Gene UCSC Ensembl | ||||||||||||||||||
| Aliases | CREB, CREB-1 | ||||||||||||||||||
| Gene name | cAMP responsive element binding protein 1 | ||||||||||||||||||
| Alternate names | cyclic AMP-responsive element-binding protein 1, active transcription factor CREB, cAMP-response element-binding protein-1, cyclic adenosine 3',5'-monophosphate response element binding protein, cyclic adenosine 3',5'-monophosphate response element-binding protein CREB, transactivator protein, | ||||||||||||||||||
| Gene location |
2q33.3 (207529891: 207605988) Exons: 14 NC_000002.12 |
||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016] |
||||||||||||||||||
| OMIM | 123810 | ||||||||||||||||||
Protein Summary |
|||||||||||||||||||
| Protein general information | P16220 Name: Cyclic AMP-responsive element-binding protein 1 (CREB-1) (cAMP-responsive element-binding protein 1) Length: 341 Mass: 36,688 | ||||||||||||||||||
| Sequence |
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQP SVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPR IEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYA QTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD | ||||||||||||||||||
| Structural information |
| ||||||||||||||||||
| Other Databases | GeneCards: CREB1; Malacards: CREB1 | ||||||||||||||||||
Gene ontology |
|||||||||||||||||||
| |||||||||||||||||||
KEGG pathways
|
|||||||||||||||||||
|
hsa05163 Human cytomegalovirus infection hsa04710 Circadian rhythm hsa04934 Cushing syndrome hsa04714 Thermogenesis hsa04713 Circadian entrainment hsa04928 Parathyroid hormone synthesis, secretion and action hsa04261 Adrenergic signaling in cardiomyocytes hsa05034 Alcoholism hsa04925 Aldosterone synthesis and secretion hsa04918 Thyroid hormone synthesis hsa04924 Renin secretion hsa04922 Glucagon signaling pathway hsa04915 Estrogen signaling pathway hsa05031 Amphetamine addiction hsa05030 Cocaine addiction hsa04927 Cortisol synthesis and secretion hsa05165 Human papillomavirus infection hsa04962 Vasopressin hsa04612 Antigen processing and presentation hsa04916 Melanogenesis hsa05016 Huntington disease hsa04926 Relaxin signaling pathway hsa04725 Cholinergic synapse hsa05203 Viral carcinogenesis hsa04022 cGMP hsa05215 Prostate cancer hsa04024 cAMP signaling pathway hsa04911 Insulin secretion hsa04152 AMPK signaling pathway hsa04668 TNF signaling pathway hsa04728 Dopaminergic synapse hsa04211 Longevity regulating pathway hsa04380 Osteoclast differentiation hsa04151 PI3K-Akt signaling pathway hsa05161 Hepatitis B hsa04931 Insulin resistance hsa05152 Tuberculosis hsa05167 Kaposi sarcoma hsa05166 Human T-cell leukemia virus 1 infection | |||||||||||||||||||
PubMed references |
|||||||||||||||||||
|
|||||||||||||||||||