Endometriosis Knowledgebase

Search Result

Gene id

1386

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ATF2 Gene UCSC Ensembl

Aliases

CRE-BP1, CREB-2, CREB2, HB16, TREB7

Gene name

activating transcription factor 2

Alternate names

cyclic AMP-dependent transcription factor ATF-2, activating transcription factor 2 splice variant ATF2-var2, cAMP response element-binding protein CRE-BP1, cAMP responsive element binding protein 2, formerly, cAMP-dependent transcription factor ATF-2, cyclic AMP-responsive element-binding protein 2, histone acetyltransferase ATF2,

Gene location

2q31.1 (175168205: 175072249) Exons: 17 NC_000002.12

Gene summary(Entrez)

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions This protein binds to the cAMP-responsive element (CRE), an octameric palindrome. It forms a homodimer or a heterodimer with c-Jun and stimulates CRE-dependent transcription. This protein is also a histone acetyltransferase (HAT) that specifically acetylates histones H2B and H4 in vitro; thus it may represent a class of sequence-specific factors that activate transcription by direct effects on chromatin components. The encoded protein may also be involved in cell's DNA damage response independent of its role in transcriptional regulation. Several alternatively spliced transcript variants have been found for this gene [provided by RefSeq, Jan 2014]

OMIM

123811

Protein Summary

Protein general information

P15336

Name: Cyclic AMP-dependent transcription factor ATF-2 (cAMP-dependent transcription factor ATF-2) (EC 2.3.1.48) (Activating transcription factor 2) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2) (HB16) (Hi

Length: 505 Mass: 54,537

Tissue specificity: Ubiquitously expressed, with more abundant expression in the brain.

Sequence

MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRF
LKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKE
VPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQ
TMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKV
WVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTE
AIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPSSQSQPSGS

Structural information

Protein Domains	bZIP. (352-415)
Motifs	Nuclear export(1-7) Nuclear export(405-414)
Interpro:	IPR029836 IPR004827 IPR016378 IPR036236 IPR013087
Prosite:	PS50217 PS00036 PS00028 PS50157
Pfam:	PF00170
PDB:	1BHI 1T2K 4H36
PDBsum:	1BHI 1T2K 4H36
DIP:	632
MINT:
STRING:	ENSP00000264110;

Other Databases

GeneCards: ATF2; Malacards: ATF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IMP	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0001076	transcription factor acti vity, RNA polymerase II t ranscription factor bindi ng	IC	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001102	RNA polymerase II activat ing transcription factor binding	IPI	molecular_function
GO:0001158	enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IC	molecular_function
GO:0003151	outflow tract morphogenes is	IEA	biological_process
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IC	molecular_function
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0004402	histone acetyltransferase activity	IDA	molecular_function
GO:0004402	histone acetyltransferase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	IMP	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IC	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006970	response to osmotic stres s	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0008140	cAMP response element bin ding protein binding	IDA	molecular_function
GO:0009414	response to water depriva tion	IEA	biological_process
GO:0016573	histone acetylation	IEA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031573	intra-S DNA damage checkp oint	IMP	biological_process
GO:0032915	positive regulation of tr ansforming growth factor beta2 production	IEA	biological_process
GO:0035497	cAMP response element bin ding	IDA	molecular_function
GO:0035861	site of double-strand bre ak	IDA	cellular_component
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0045444	fat cell differentiation	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0050680	negative regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0060612	adipose tissue developmen t	IEA	biological_process
GO:0097186	amelogenesis	IEA	biological_process
GO:1902110	positive regulation of mi tochondrial membrane perm eability involved in apop totic process	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IMP	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0001076	transcription factor acti vity, RNA polymerase II t ranscription factor bindi ng	IC	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001102	RNA polymerase II activat ing transcription factor binding	IPI	molecular_function
GO:0001158	enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IC	molecular_function
GO:0003151	outflow tract morphogenes is	IEA	biological_process
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003682	chromatin binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IC	molecular_function
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0004402	histone acetyltransferase activity	IEA	molecular_function
GO:0004402	histone acetyltransferase activity	IDA	molecular_function
GO:0004402	histone acetyltransferase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005741	mitochondrial outer membr ane	IEA	cellular_component
GO:0005741	mitochondrial outer membr ane	IEA	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IMP	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IC	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006970	response to osmotic stres s	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008140	cAMP response element bin ding protein binding	IDA	molecular_function
GO:0009414	response to water depriva tion	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016573	histone acetylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031573	intra-S DNA damage checkp oint	IMP	biological_process
GO:0032915	positive regulation of tr ansforming growth factor beta2 production	IEA	biological_process
GO:0035497	cAMP response element bin ding	IEA	molecular_function
GO:0035497	cAMP response element bin ding	IDA	molecular_function
GO:0035861	site of double-strand bre ak	IDA	cellular_component
GO:0043525	positive regulation of ne uron apoptotic process	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0045444	fat cell differentiation	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0050680	negative regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0060612	adipose tissue developmen t	IEA	biological_process
GO:0097186	amelogenesis	IEA	biological_process
GO:1902110	positive regulation of mi tochondrial membrane perm eability involved in apop totic process	IMP	biological_process
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IMP	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0001076	transcription factor acti vity, RNA polymerase II t ranscription factor bindi ng	IC	molecular_function
GO:0001102	RNA polymerase II activat ing transcription factor binding	IPI	molecular_function
GO:0001158	enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IC	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IC	molecular_function
GO:0003713	transcription coactivator activity	TAS	molecular_function
GO:0004402	histone acetyltransferase activity	IDA	molecular_function
GO:0004402	histone acetyltransferase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005741	mitochondrial outer membr ane	IDA	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	IMP	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IC	biological_process
GO:0006970	response to osmotic stres s	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological_process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological_process
GO:0008140	cAMP response element bin ding protein binding	IDA	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0031573	intra-S DNA damage checkp oint	IMP	biological_process
GO:0035497	cAMP response element bin ding	IDA	molecular_function
GO:0035861	site of double-strand bre ak	IDA	cellular_component
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	TAS	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:1902110	positive regulation of mi tochondrial membrane perm eability involved in apop totic process	IMP	biological_process

KEGG pathways

hsa04925  Aldosterone synthesis and secretion
hsa05030  Cocaine addiction
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05034  Alcoholism
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04934  Cushing's syndrome
hsa04927  Cortisol synthesis and secretion
hsa04915  Estrogen signaling pathway
hsa05166  HTLV-I infection
hsa04918  Thyroid hormone synthesis
hsa05164  Influenza A
hsa04668  TNF signaling pathway
hsa05031  Amphetamine addiction
hsa04022  cGMP-PKG signaling pathway
hsa05169  Epstein-Barr virus infection
hsa04922  Glucagon signaling pathway
hsa04926  Relaxin signaling pathway
hsa05161  Hepatitis B
hsa04714  Thermogenesis
hsa04010  MAPK signaling pathway
hsa05203  Viral carcinogenesis
hsa04151  PI3K-Akt signaling pathway

Diseases

Associated diseases	References
Endometriosis	INFBASE27041028

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
27041028	Endometrio sis			106 (62 control s, 44 endometri osis)		Rac1 MMP3 ATF-2 SDC4	Show abstract