Endometriosis Knowledgebase

Search Result

Gene id

1392

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CRH Gene UCSC Ensembl

Aliases

CRF, CRH1

Gene name

corticotropin releasing hormone

Alternate names

corticoliberin, corticotropin-releasing factor,

Gene location

8q13.1 (66186684: 66176376) Exons: 7 NC_000008.11

Gene summary(Entrez)

This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus, binds to corticotropin releasing hormone receptors and stimulates the release of adrenocorticotropic hormone from the pituitary gland. Marked reduction in this protein has been observed in association with Alzheimer's disease. Autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of the hormone occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, this protein may act as a trigger for parturition. [provided by RefSeq, Nov 2015]

OMIM

122560

Protein Summary

Protein general information

P06850

Name: Corticoliberin (Corticotropin releasing factor) (CRF) (Corticotropin releasing hormone)

Length: 196 Mass: 21,422

Tissue specificity: Produced by the hypothalamus and placenta. {ECO

Sequence

MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLR
LGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPER
ERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK

Structural information

Interpro:	IPR018446 IPR000187 IPR003620
Prosite:	PS00511
Pfam:	PF00473
PDB:	1GO9 1GOE 3EHT 3EHU
PDBsum:	1GO9 1GOE 3EHT 3EHU
STRING:	ENSP00000276571;

Other Databases

GeneCards: CRH; Malacards: CRH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0001963	synaptic transmission, do paminergic	IDA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005184	neuropeptide hormone acti vity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006704	glucocorticoid biosynthet ic process	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007565	female pregnancy	IDA	biological_process
GO:0007567	parturition	TAS	biological_process
GO:0007611	learning or memory	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008306	associative learning	IEA	biological_process
GO:0008628	hormone-mediated apoptoti c signaling pathway	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010700	negative regulation of no repinephrine secretion	IEA	biological_process
GO:0010841	positive regulation of ci rcadian sleep/wake cycle, wakefulness	NAS	biological_process
GO:0010942	positive regulation of ce ll death	IEA	biological_process
GO:0014062	regulation of serotonin s ecretion	IEA	biological_process
GO:0016101	diterpenoid metabolic pro cess	IEA	biological_process
GO:0021854	hypothalamus development	IEA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030325	adrenal gland development	IEA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IEA	biological_process
GO:0032811	negative regulation of ep inephrine secretion	IEA	biological_process
GO:0033685	negative regulation of lu teinizing hormone secreti on	IEA	biological_process
GO:0035641	locomotory exploration be havior	IEA	biological_process
GO:0035774	positive regulation of in sulin secretion involved in cellular response to g lucose stimulus	IEA	biological_process
GO:0035902	response to immobilizatio n stress	IEA	biological_process
GO:0042322	negative regulation of ci rcadian sleep/wake cycle, REM sleep	NAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043196	varicosity	IEA	cellular_component
GO:0043204	perikaryon	IEA	cellular_component
GO:0043627	response to estrogen	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045472	response to ether	IEA	biological_process
GO:0045776	negative regulation of bl ood pressure	IEA	biological_process
GO:0048265	response to pain	IEA	biological_process
GO:0050801	ion homeostasis	IEA	biological_process
GO:0051412	response to corticosteron e	IEA	biological_process
GO:0051430	corticotropin-releasing h ormone receptor 1 binding	IEA	molecular_function
GO:0051431	corticotropin-releasing h ormone receptor 2 binding	IEA	molecular_function
GO:0051461	positive regulation of co rticotropin secretion	IEA	biological_process
GO:0051464	positive regulation of co rtisol secretion	IDA	biological_process
GO:0060291	long-term synaptic potent iation	IEA	biological_process
GO:0060456	positive regulation of di gestive system process	IEA	biological_process
GO:0060548	negative regulation of ce ll death	IEA	biological_process
GO:0070093	negative regulation of gl ucagon secretion	IEA	biological_process
GO:0071314	cellular response to coca ine	IEA	biological_process
GO:0071549	cellular response to dexa methasone stimulus	IEA	biological_process
GO:0090280	positive regulation of ca lcium ion import	IEA	biological_process
GO:2000310	regulation of N-methyl-D- aspartate selective gluta mate receptor activity	IDA	biological_process
GO:2000854	positive regulation of co rticosterone secretion	IEA	biological_process
GO:2000987	positive regulation of be havioral fear response	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0001963	synaptic transmission, do paminergic	IEA	biological_process
GO:0001963	synaptic transmission, do paminergic	IDA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005184	neuropeptide hormone acti vity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006704	glucocorticoid biosynthet ic process	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007565	female pregnancy	IDA	biological_process
GO:0007565	female pregnancy	TAS	biological_process
GO:0007567	parturition	TAS	biological_process
GO:0007611	learning or memory	IEA	biological_process
GO:0007611	learning or memory	TAS	biological_process
GO:0008202	steroid metabolic process	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008306	associative learning	IEA	biological_process
GO:0008628	hormone-mediated apoptoti c signaling pathway	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010700	negative regulation of no repinephrine secretion	IEA	biological_process
GO:0010841	positive regulation of ci rcadian sleep/wake cycle, wakefulness	NAS	biological_process
GO:0010942	positive regulation of ce ll death	IEA	biological_process
GO:0014062	regulation of serotonin s ecretion	IEA	biological_process
GO:0016101	diterpenoid metabolic pro cess	IEA	biological_process
GO:0021854	hypothalamus development	IEA	biological_process
GO:0030324	lung development	IEA	biological_process
GO:0030325	adrenal gland development	IEA	biological_process
GO:0030819	positive regulation of cA MP biosynthetic process	IEA	biological_process
GO:0032811	negative regulation of ep inephrine secretion	IEA	biological_process
GO:0033685	negative regulation of lu teinizing hormone secreti on	IEA	biological_process
GO:0035641	locomotory exploration be havior	IEA	biological_process
GO:0035774	positive regulation of in sulin secretion involved in cellular response to g lucose stimulus	IEA	biological_process
GO:0035902	response to immobilizatio n stress	IEA	biological_process
GO:0042220	response to cocaine	IEA	biological_process
GO:0042322	negative regulation of ci rcadian sleep/wake cycle, REM sleep	NAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043196	varicosity	IEA	cellular_component
GO:0043204	perikaryon	IEA	cellular_component
GO:0043627	response to estrogen	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045472	response to ether	IEA	biological_process
GO:0045776	negative regulation of bl ood pressure	IEA	biological_process
GO:0048265	response to pain	IEA	biological_process
GO:0050801	ion homeostasis	IEA	biological_process
GO:0051412	response to corticosteron e	IEA	biological_process
GO:0051430	corticotropin-releasing h ormone receptor 1 binding	IEA	molecular_function
GO:0051431	corticotropin-releasing h ormone receptor 2 binding	IEA	molecular_function
GO:0051461	positive regulation of co rticotropin secretion	IEA	biological_process
GO:0051464	positive regulation of co rtisol secretion	IDA	biological_process
GO:0060291	long-term synaptic potent iation	IEA	biological_process
GO:0060456	positive regulation of di gestive system process	IEA	biological_process
GO:0060548	negative regulation of ce ll death	IEA	biological_process
GO:0070093	negative regulation of gl ucagon secretion	IEA	biological_process
GO:0071314	cellular response to coca ine	IEA	biological_process
GO:0071549	cellular response to dexa methasone stimulus	IEA	biological_process
GO:0090280	positive regulation of ca lcium ion import	IEA	biological_process
GO:2000310	regulation of N-methyl-D- aspartate selective gluta mate receptor activity	IEA	biological_process
GO:2000310	regulation of N-methyl-D- aspartate selective gluta mate receptor activity	IDA	biological_process
GO:2000854	positive regulation of co rticosterone secretion	IEA	biological_process
GO:2000987	positive regulation of be havioral fear response	IEA	biological_process
GO:0001963	synaptic transmission, do paminergic	IDA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005184	neuropeptide hormone acti vity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006954	inflammatory response	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007268	chemical synaptic transmi ssion	TAS	biological_process
GO:0007565	female pregnancy	IDA	biological_process
GO:0007565	female pregnancy	TAS	biological_process
GO:0007567	parturition	TAS	biological_process
GO:0007611	learning or memory	TAS	biological_process
GO:0010841	positive regulation of ci rcadian sleep/wake cycle, wakefulness	NAS	biological_process
GO:0042322	negative regulation of ci rcadian sleep/wake cycle, REM sleep	NAS	biological_process
GO:0051464	positive regulation of co rtisol secretion	IDA	biological_process
GO:2000310	regulation of N-methyl-D- aspartate selective gluta mate receptor activity	IDA	biological_process

KEGG pathways

hsa05034 Alcoholism
hsa04730 Long-term depression

Diseases

Associated diseases	References
Arthritis	PMID: 12734882
Attention-deficit hyperactivity disorder (ADHD)	PMID: 11140838
Bipolar disorder	PMID: 10893493
Connective tissue diseases	PMID: 19527514
Depression	PMID: 14573312
Endometrial cancer	PMID: 19433256
Endometriosis	PMID: 9633021
Endometriosis	PMID: 23638035
Functional hypothalamic amenorrhea	PMID: 10764453
Obesity	PMID: 14724656
Polymyalgia rheumatica	PMID: 12051390
Psychiatric disorders	PMID: 19086053
schizophrenia	PMID: 18838498
Endometriosis	INFBASE21289256

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23638035	Endometrio sis			26 (16 women wi th endometriosi s, 10 healthy w omen)		CRH UCN CRHR1 CRHR2	Show abstract
21289256	Endometrio sis					CRH Ucn	Show abstract