Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 1395
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol CRHR2   Gene   UCSC   Ensembl
Aliases CRF-RB, CRF2, CRFR2, HM-CRF
Gene name corticotropin releasing hormone receptor 2
Alternate names corticotropin-releasing factor receptor 2, CRF2 receptor, beta isoform, CRH receptor 2 variant B, CRH-R2,
Gene location 7p14.3 (30700102: 30651843)     Exons: 16     NC_000007.14
Gene summary(Entrez) The protein encoded by this gene belongs to the G-protein coupled receptor 2 family, and the subfamily of corticotropin releasing hormone receptor. This receptor shows high affinity for corticotropin releasing hormone (CRH), and also binds CRH-related peptides such as urocortin. CRH is synthesized in the hypothalamus, and plays an important role in coordinating the endocrine, autonomic, and behavioral responses to stress and immune challenge. Studies in mice suggest that this receptor maybe involved in mediating cardiovascular homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jan 2011]
OMIM 602034

Protein Summary

Protein general information Q13324  

Name: Corticotropin releasing factor receptor 2 (CRF R 2) (CRF R2) (CRFR 2) (Corticotropin releasing hormone receptor 2) (CRH R 2) (CRH R2)

Length: 411  Mass: 47,688

Sequence MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNT
TRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNV
IHWNLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKC
LFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYCFFNGEVRSAVRKRWH
RWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV
Structural information
Interpro:  IPR017981 IPR003053 IPR003051 IPR001879 IPR000832 IPR017983
Prosite:   PS00649 PS00650 PS50227 PS50261

Pfam:  
PF00002 PF02793

PDB:  
3N93 3N95 3N96
PDBsum:   3N93 3N95 3N96
STRING:   ENSP00000340943;
Other Databases GeneCards:  CRHR2;  Malacards:  CRHR2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
IPI molecular_function
GO:0005791 rough endoplasmic reticul
um
IEA cellular_component
GO:0005794 Golgi apparatus
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0007015 actin filament organizati
on
IEA biological_process
GO:0007166 cell surface receptor sig
naling pathway
IEA biological_process
GO:0007188 adenylate cyclase-modulat
ing G-protein coupled rec
eptor signaling pathway
TAS biological_process
GO:0007205 protein kinase C-activati
ng G-protein coupled rece
ptor signaling pathway
IEA biological_process
GO:0009755 hormone-mediated signalin
g pathway
IEA biological_process
GO:0010460 positive regulation of he
art rate
IEA biological_process
GO:0010629 negative regulation of ge
ne expression
IEA biological_process
GO:0010700 negative regulation of no
repinephrine secretion
IEA biological_process
GO:0014064 positive regulation of se
rotonin secretion
IEA biological_process
GO:0015056 corticotrophin-releasing
factor receptor activity
TAS molecular_function
GO:0017046 peptide hormone binding
IEA molecular_function
GO:0019233 sensory perception of pai
n
IEA biological_process
GO:0021549 cerebellum development
IEA biological_process
GO:0021854 hypothalamus development
IEA biological_process
GO:0030425 dendrite
IEA cellular_component
GO:0030818 negative regulation of cA
MP biosynthetic process
IEA biological_process
GO:0030819 positive regulation of cA
MP biosynthetic process
IEA biological_process
GO:0030855 epithelial cell different
iation
IEA biological_process
GO:0032755 positive regulation of in
terleukin-6 production
IEA biological_process
GO:0032811 negative regulation of ep
inephrine secretion
IEA biological_process
GO:0032874 positive regulation of st
ress-activated MAPK casca
de
IEA biological_process
GO:0033685 negative regulation of lu
teinizing hormone secreti
on
IEA biological_process
GO:0035482 gastric motility
IEA biological_process
GO:0042423 catecholamine biosyntheti
c process
IEA biological_process
GO:0043196 varicosity
IEA cellular_component
GO:0043204 perikaryon
IEA cellular_component
GO:0043404 corticotropin-releasing h
ormone receptor activity
IEA molecular_function
GO:0043679 axon terminus
IEA cellular_component
GO:0045777 positive regulation of bl
ood pressure
IEA biological_process
GO:0046882 negative regulation of fo
llicle-stimulating hormon
e secretion
IEA biological_process
GO:0048630 skeletal muscle tissue gr
owth
IEA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IEA biological_process
GO:0060291 long-term synaptic potent
iation
IEA biological_process
GO:0061179 negative regulation of in
sulin secretion involved
in cellular response to g
lucose stimulus
IEA biological_process
GO:0070372 regulation of ERK1 and ER
K2 cascade
IEA biological_process
GO:0070852 cell body fiber
IEA cellular_component
GO:0071376 cellular response to cort
icotropin-releasing hormo
ne stimulus
IEA biological_process
GO:0071385 cellular response to gluc
ocorticoid stimulus
IEA biological_process
GO:0090281 negative regulation of ca
lcium ion import
IEA biological_process
GO:2000252 negative regulation of fe
eding behavior
IEA biological_process
GO:2000293 negative regulation of de
fecation
IEA biological_process
GO:0004871 signal transducer activit
y
IEA molecular_function
GO:0004888 transmembrane signaling r
eceptor activity
IEA molecular_function
GO:0004930 G-protein coupled recepto
r activity
IEA molecular_function
GO:0004930 G-protein coupled recepto
r activity
IEA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005791 rough endoplasmic reticul
um
IEA cellular_component
GO:0005794 Golgi apparatus
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0007015 actin filament organizati
on
IEA biological_process
GO:0007165 signal transduction
IEA biological_process
GO:0007166 cell surface receptor sig
naling pathway
IEA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IEA biological_process
GO:0007186 G-protein coupled recepto
r signaling pathway
IEA biological_process
GO:0007188 adenylate cyclase-modulat
ing G-protein coupled rec
eptor signaling pathway
TAS biological_process
GO:0007205 protein kinase C-activati
ng G-protein coupled rece
ptor signaling pathway
IEA biological_process
GO:0009755 hormone-mediated signalin
g pathway
IEA biological_process
GO:0010460 positive regulation of he
art rate
IEA biological_process
GO:0010628 positive regulation of ge
ne expression
IEA biological_process
GO:0010629 negative regulation of ge
ne expression
IEA biological_process
GO:0010700 negative regulation of no
repinephrine secretion
IEA biological_process
GO:0014064 positive regulation of se
rotonin secretion
IEA biological_process
GO:0015056 corticotrophin-releasing
factor receptor activity
TAS molecular_function
GO:0016020 membrane
IEA cellular_component
GO:0016020 membrane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0017046 peptide hormone binding
IEA molecular_function
GO:0019233 sensory perception of pai
n
IEA biological_process
GO:0021549 cerebellum development
IEA biological_process
GO:0021854 hypothalamus development
IEA biological_process
GO:0030424 axon
IEA cellular_component
GO:0030425 dendrite
IEA cellular_component
GO:0030816 positive regulation of cA
MP metabolic process
IEA biological_process
GO:0030818 negative regulation of cA
MP biosynthetic process
IEA biological_process
GO:0030819 positive regulation of cA
MP biosynthetic process
IEA biological_process
GO:0030855 epithelial cell different
iation
IEA biological_process
GO:0032755 positive regulation of in
terleukin-6 production
IEA biological_process
GO:0032811 negative regulation of ep
inephrine secretion
IEA biological_process
GO:0032874 positive regulation of st
ress-activated MAPK casca
de
IEA biological_process
GO:0033685 negative regulation of lu
teinizing hormone secreti
on
IEA biological_process
GO:0035482 gastric motility
IEA biological_process
GO:0042423 catecholamine biosyntheti
c process
IEA biological_process
GO:0043025 neuronal cell body
IEA cellular_component
GO:0043196 varicosity
IEA cellular_component
GO:0043204 perikaryon
IEA cellular_component
GO:0043404 corticotropin-releasing h
ormone receptor activity
IEA molecular_function
GO:0043679 axon terminus
IEA cellular_component
GO:0045777 positive regulation of bl
ood pressure
IEA biological_process
GO:0046882 negative regulation of fo
llicle-stimulating hormon
e secretion
IEA biological_process
GO:0048630 skeletal muscle tissue gr
owth
IEA biological_process
GO:0051092 positive regulation of NF
-kappaB transcription fac
tor activity
IEA biological_process
GO:0060291 long-term synaptic potent
iation
IEA biological_process
GO:0061179 negative regulation of in
sulin secretion involved
in cellular response to g
lucose stimulus
IEA biological_process
GO:0070372 regulation of ERK1 and ER
K2 cascade
IEA biological_process
GO:0070852 cell body fiber
IEA cellular_component
GO:0071376 cellular response to cort
icotropin-releasing hormo
ne stimulus
IEA biological_process
GO:0071385 cellular response to gluc
ocorticoid stimulus
IEA biological_process
GO:0090281 negative regulation of ca
lcium ion import
IEA biological_process
GO:2000252 negative regulation of fe
eding behavior
IEA biological_process
GO:2000293 negative regulation of de
fecation
IEA biological_process
GO:0005515 protein binding
IPI molecular_function
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
TAS cellular_component
GO:0007188 adenylate cyclase-modulat
ing G-protein coupled rec
eptor signaling pathway
TAS biological_process
GO:0015056 corticotrophin-releasing
factor receptor activity
TAS molecular_function

KEGG pathways

hsa04080  Neuroactive ligand-receptor interaction

Diseases

Associated diseases References
Asthma PMID: 18408560
Connective tissue diseases PMID: 19527514
Depression PMID: 11857585
Endometrial cancer PMID: 19433256
Endometriosis PMID: 23638035
Obesity PMID: 14724656
Panic disorder PMID: 16691126
Personality disorders PMID: 16884458
Psychiatric disorders PMID: 19086053
Schizophrenia PMID: 18838498
Endometriosis INFBASE23638035

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
23638035 Endometrio
sis

26 (16 women wi
th endometriosi
s, 10 healthy w
omen)
CRH
UCN
CRHR1
CRHR2
Show abstract
27567427 Endometrio
sis

48 (22 ovarian
endometrioma, 2
6 deep infiltra
ting endometrio
sis)
CRH
UCN
UCN2
CRHR2
PLA2G2A
COX2
Show abstract