Endometriosis Knowledgebase

Search Result

Gene id

140628

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

GATA5 Gene UCSC Ensembl

Aliases

GATAS, bB379O24.1

Gene name

GATA binding protein 5

Alternate names

transcription factor GATA-5, GATA binding factor-5,

Gene location

20q13.33 (62475969: 62463496) Exons: 8 NC_000020.11

Gene summary(Entrez)

The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity. [provided by RefSeq, Jul 2008]

OMIM

611496

Protein Summary

Protein general information

Q9BWX5

Name: Transcription factor GATA 5 (GATA binding factor 5)

Length: 397 Mass: 41,299

Sequence

MYQSLALAASPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCEPSPQPPELAARPGWAQTATADSSAF
GPGSPHPPAAHPPGATAFPFAHSPSGPGSGGSAGGRDGSAYQGALLPREQFAAPLGRPVGTSYSATYPAYVSPDV
AQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRP
LVRPQKRLSSSRRAGLCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKTIAKA
RGSSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFPSTA
PSPQAGLRGALRQEAWCALALA

Structural information

Interpro:	IPR008013 IPR028372 IPR016375 IPR000679 IPR013088
Prosite:	PS00344 PS50114
Pfam:	PF00320 PF05349
STRING:	ENSP00000252997;

Other Databases

GeneCards: GATA5; Malacards: GATA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IBA	molecular_function
GO:0001085	RNA polymerase II transcr iption factor binding	IBA	molecular_function
GO:0001158	enhancer sequence-specifi c DNA binding	IEA	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IBA	molecular_function
GO:0003682	chromatin binding	IBA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IEA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IBA	cellular_component
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0007507	heart development	IBA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0009887	animal organ morphogenesi s	IBA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048468	cell development	IBA	biological_process
GO:0048646	anatomical structure form ation involved in morphog enesis	IBA	biological_process
GO:0060575	intestinal epithelial cel l differentiation	IDA	biological_process
GO:0071773	cellular response to BMP stimulus	IEA	biological_process
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IBA	molecular_function
GO:0001085	RNA polymerase II transcr iption factor binding	IBA	molecular_function
GO:0001158	enhancer sequence-specifi c DNA binding	IEA	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IBA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003682	chromatin binding	IBA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IEA	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IBA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0007507	heart development	IBA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008270	zinc ion binding	IEA	molecular_function
GO:0009887	animal organ morphogenesi s	IBA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IEA	molecular_function
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048468	cell development	IBA	biological_process
GO:0048646	anatomical structure form ation involved in morphog enesis	IBA	biological_process
GO:0060575	intestinal epithelial cel l differentiation	IDA	biological_process
GO:0071773	cellular response to BMP stimulus	IEA	biological_process
GO:0000977	RNA polymerase II regulat ory region sequence-speci fic DNA binding	IBA	molecular_function
GO:0001085	RNA polymerase II transcr iption factor binding	IBA	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IBA	molecular_function
GO:0003682	chromatin binding	IBA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IBA	cellular_component
GO:0007507	heart development	IBA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0009887	animal organ morphogenesi s	IBA	biological_process
GO:0044212	transcription regulatory region DNA binding	IDA	molecular_function
GO:0045165	cell fate commitment	IBA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0048468	cell development	IBA	biological_process
GO:0048646	anatomical structure form ation involved in morphog enesis	IBA	biological_process
GO:0060575	intestinal epithelial cel l differentiation	IDA	biological_process

Diseases

Associated diseases	References
Endometriosis (ovarian)	PMID: 23656391
Ovarian endometriosis	PMID: 23656391
Ovarian endometriosis	INFBASE23656391

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23656391	Endometrio sis (ovari an)			11 women with e ndometriosis an d endometrial t issue of the co ntrols		GATA5 SLCO4A1	Show abstract