Endometriosis Knowledgebase

Search Result

Gene id

1435

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CSF1 Gene UCSC Ensembl

Aliases

CSF-1, MCSF

Gene name

colony stimulating factor 1

Alternate names

macrophage colony-stimulating factor 1, colony stimulating factor 1 (macrophage), lanimostim, macrophage colony stimulating factor 1,

Gene location

1p13.3 (109910505: 109930993) Exons: 10 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]

OMIM

120420

Protein Summary

Protein general information

P09603

Name: Macrophage colony stimulating factor 1 (CSF 1) (M CSF) (MCSF) (Lanimostim) [Cleaved into: Processed macrophage colony stimulating factor 1]

Length: 554 Mass: 60,179

Sequence

MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQL
KDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVK
NVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWED
SEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPADVTGTALPRVGPVRP
TGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLSAQPQLSRSHSSGSVLPLGELEGRRSTRDRR
SPAEPEGGPASEGAARPLPRFNSVPLTDTGHERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSH
QEPQRADSPLEQPEGSPLTQDDRQVELPV

Structural information

Interpro:	IPR009079 IPR008001
Pfam:	PF05337
PDB:	1HMC 3UEZ 3UF2 4ADF 4FA8 4WRL 4WRM
PDBsum:	1HMC 3UEZ 3UF2 4ADF 4FA8 4WRL 4WRM
DIP:	41860
MINT:	196477
STRING:	ENSP00000327513;

Other Databases

GeneCards: CSF1; Malacards: CSF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001503	ossification	IEA	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	ISS	biological_process
GO:0002158	osteoclast proliferation	IEA	biological_process
GO:0003006	developmental process inv olved in reproduction	ISS	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005157	macrophage colony-stimula ting factor receptor bind ing	ISS	molecular_function
GO:0005157	macrophage colony-stimula ting factor receptor bind ing	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IDA	biological_process
GO:0008083	growth factor activity	NAS	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008283	cell proliferation	NAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010743	regulation of macrophage derived foam cell differe ntiation	NAS	biological_process
GO:0010744	positive regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010759	positive regulation of ma crophage chemotaxis	IDA	biological_process
GO:0016020	membrane	NAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030097	hemopoiesis	NAS	biological_process
GO:0030154	cell differentiation	NAS	biological_process
GO:0030225	macrophage differentiatio n	TAS	biological_process
GO:0030278	regulation of ossificatio n	IEA	biological_process
GO:0030316	osteoclast differentiatio n	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	ISS	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032946	positive regulation of mo nonuclear cell proliferat ion	IDA	biological_process
GO:0038145	macrophage colony-stimula ting factor signaling pat hway	IEA	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IEA	biological_process
GO:0042117	monocyte activation	NAS	biological_process
GO:0042476	odontogenesis	IEA	biological_process
GO:0042488	positive regulation of od ontogenesis of dentin-con taining tooth	IEA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0045087	innate immune response	IEA	biological_process
GO:0045651	positive regulation of ma crophage differentiation	IDA	biological_process
GO:0045657	positive regulation of mo nocyte differentiation	ISS	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological_process
GO:0045860	positive regulation of pr otein kinase activity	ISS	biological_process
GO:0046579	positive regulation of Ra s protein signal transduc tion	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological_process
GO:0060444	branching involved in mam mary gland duct morphogen esis	IEA	biological_process
GO:0060611	mammary gland fat develop ment	IEA	biological_process
GO:0060763	mammary duct terminal end bud growth	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1902228	positive regulation of ma crophage colony-stimulati ng factor signaling pathw ay	IDA	biological_process
GO:1904141	positive regulation of mi croglial cell migration	IDA	biological_process
GO:1990682	CSF1-CSF1R complex	ISS	cellular_component
GO:0001503	ossification	IEA	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	IEA	biological_process
GO:0001954	positive regulation of ce ll-matrix adhesion	ISS	biological_process
GO:0002158	osteoclast proliferation	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0003006	developmental process inv olved in reproduction	IEA	biological_process
GO:0003006	developmental process inv olved in reproduction	ISS	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005157	macrophage colony-stimula ting factor receptor bind ing	IEA	molecular_function
GO:0005157	macrophage colony-stimula ting factor receptor bind ing	ISS	molecular_function
GO:0005157	macrophage colony-stimula ting factor receptor bind ing	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IDA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	NAS	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008283	cell proliferation	IEA	biological_process
GO:0008283	cell proliferation	NAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010743	regulation of macrophage derived foam cell differe ntiation	NAS	biological_process
GO:0010744	positive regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010759	positive regulation of ma crophage chemotaxis	IDA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	NAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0030097	hemopoiesis	NAS	biological_process
GO:0030154	cell differentiation	NAS	biological_process
GO:0030225	macrophage differentiatio n	IEA	biological_process
GO:0030225	macrophage differentiatio n	TAS	biological_process
GO:0030278	regulation of ossificatio n	IEA	biological_process
GO:0030316	osteoclast differentiatio n	IEA	biological_process
GO:0030316	osteoclast differentiatio n	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	ISS	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032946	positive regulation of mo nonuclear cell proliferat ion	IDA	biological_process
GO:0038145	macrophage colony-stimula ting factor signaling pat hway	IEA	biological_process
GO:0040018	positive regulation of mu lticellular organism grow th	IEA	biological_process
GO:0042117	monocyte activation	NAS	biological_process
GO:0042476	odontogenesis	IEA	biological_process
GO:0042488	positive regulation of od ontogenesis of dentin-con taining tooth	IEA	biological_process
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0045087	innate immune response	IEA	biological_process
GO:0045651	positive regulation of ma crophage differentiation	IEA	biological_process
GO:0045651	positive regulation of ma crophage differentiation	IDA	biological_process
GO:0045657	positive regulation of mo nocyte differentiation	IEA	biological_process
GO:0045657	positive regulation of mo nocyte differentiation	ISS	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IEA	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological_process
GO:0045860	positive regulation of pr otein kinase activity	IEA	biological_process
GO:0045860	positive regulation of pr otein kinase activity	ISS	biological_process
GO:0046579	positive regulation of Ra s protein signal transduc tion	IEA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological_process
GO:0060444	branching involved in mam mary gland duct morphogen esis	IEA	biological_process
GO:0060611	mammary gland fat develop ment	IEA	biological_process
GO:0060763	mammary duct terminal end bud growth	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1902228	positive regulation of ma crophage colony-stimulati ng factor signaling pathw ay	IDA	biological_process
GO:1904141	positive regulation of mi croglial cell migration	IDA	biological_process
GO:1990682	CSF1-CSF1R complex	IEA	cellular_component
GO:1990682	CSF1-CSF1R complex	ISS	cellular_component
GO:0001954	positive regulation of ce ll-matrix adhesion	ISS	biological_process
GO:0003006	developmental process inv olved in reproduction	ISS	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005157	macrophage colony-stimula ting factor receptor bind ing	ISS	molecular_function
GO:0005157	macrophage colony-stimula ting factor receptor bind ing	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IDA	biological_process
GO:0008083	growth factor activity	NAS	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008283	cell proliferation	NAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010743	regulation of macrophage derived foam cell differe ntiation	NAS	biological_process
GO:0010744	positive regulation of ma crophage derived foam cel l differentiation	IDA	biological_process
GO:0010759	positive regulation of ma crophage chemotaxis	IDA	biological_process
GO:0016020	membrane	NAS	cellular_component
GO:0030097	hemopoiesis	NAS	biological_process
GO:0030154	cell differentiation	NAS	biological_process
GO:0030225	macrophage differentiatio n	TAS	biological_process
GO:0030316	osteoclast differentiatio n	IDA	biological_process
GO:0030335	positive regulation of ce ll migration	ISS	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032946	positive regulation of mo nonuclear cell proliferat ion	IDA	biological_process
GO:0042117	monocyte activation	NAS	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0045651	positive regulation of ma crophage differentiation	IDA	biological_process
GO:0045657	positive regulation of mo nocyte differentiation	ISS	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological_process
GO:0045860	positive regulation of pr otein kinase activity	ISS	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:1902228	positive regulation of ma crophage colony-stimulati ng factor signaling pathw ay	IDA	biological_process
GO:1904141	positive regulation of mi croglial cell migration	IDA	biological_process
GO:1990682	CSF1-CSF1R complex	ISS	cellular_component

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04668  TNF signaling pathway
hsa04380  Osteoclast differentiation
hsa05323  Rheumatoid arthritis
hsa04640  Hematopoietic cell lineage

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 17192722
Cancer	PMID: 17355643
Endometrial cancer	PMID: 9815987
Endometriosis	PMID: 22365076
Female infertility	PMID: 9410394
Follicular development	PMID: 18996518
Male infertility	PMID: 8554432
Periodontitis	PMID: 16844084
Polycystic ovary syndrome (PCOS)	PMID: 16997933
Endometriosis associated infertility	INFBASE8073433
Endometriosis	INFBASE8073433

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
22365076	Endometrio sis			CSF-1 C-FMS	Show abstract
21481374	Endometrio sis			CSF-1	Show abstract
8073433	Endometrio sis	44 infertile pa tients	Female infertility	M-CSF	Show abstract